Dynamic Programming Longest Common Subsequence. Class 27
|
|
- Ingeborg Bråthen
- 5 år siden
- Visninger:
Transkript
1 Dynamic Programming Longest Common Subsequence Class 27
2 Protein a protein is a complex molecule composed of long single-strand chains of amino acid molecules there are 20 amino acids that make up proteins the primary structure of a protein is the sequence of its amino acids
3 Protein a protein is a complex molecule composed of long single-strand chains of amino acid molecules there are 20 amino acids that make up proteins the primary structure of a protein is the sequence of its amino acids given a new unknown protein, it is relatively easy to determine the primary structure since there are 20 amino acids, and 26 Roman letters, we represent a protein s primary structure as a string of letters
4 Protein a protein is a complex molecule composed of long single-strand chains of amino acid molecules there are 20 amino acids that make up proteins the primary structure of a protein is the sequence of its amino acids given a new unknown protein, it is relatively easy to determine the primary structure since there are 20 amino acids, and 26 Roman letters, we represent a protein s primary structure as a string of letters A alanine C cysteine D aspartic acid E glutamic acid etc.
5 A Protein human breast cancer susceptibility protein 1: MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQ LDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSE DTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASS LQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLN SSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKAS LPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQN EKNPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQM PVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLML SGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIE MEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVD NAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIREN VFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYL ISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEE LPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPF LIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQE MAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSKCPSL DDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTS ALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTD AEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQL CGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY
6 Similarity however, while the primary sequence is essential to understanding function, it is not sufficient an approach to understanding function is to compare the unknown sequence with the sequences of proteins whose functions are known two proteins with similar sequences may have similar functions the question is the same as with string alignment: what is similar? what metric do we use?
7 Similarity however, while the primary sequence is essential to understanding function, it is not sufficient an approach to understanding function is to compare the unknown sequence with the sequences of proteins whose functions are known two proteins with similar sequences may have similar functions the question is the same as with string alignment: what is similar? what metric do we use? we can use string alignment for proteins, another common similarity metric is measuring the longest common subsequence
8 Longest Common Subsequence what is the longest list of letters, in order, in both strings? H S R E T S I E M E E S T V S T I S R N N I R E
9 Longest Common Subsequence what is the longest list of letters, in order, in both strings? H S R E T S I E M E E S S T S I E T V S T I S R N N I R E
10 given two sequences Step 1 s[0..n 1] and t[0..m 1] we wish to find a longest common subsequence, i.e., a subsequence of s: s[i 0 ],..., s[i k 1 ] and of t such that t[j 0 ],..., t[j k 1 ] s[i 0 ] = t[j 0 ],..., s[i k 1 ] = t[j k 1 ] where k is as long as possible
11 given two sequences Step 1 s[0..n 1] and t[0..m 1] we wish to find a longest common subsequence, i.e., a subsequence of s: s[i 0 ],..., s[i k 1 ] and of t such that t[j 0 ],..., t[j k 1 ] s[i 0 ] = t[j 0 ],..., s[i k 1 ] = t[j k 1 ] where k is as long as possible let opt(i, j) be the optimum length of a common subsequence of s[0..i] and t[0..j] where 0 i < n and 0 j < m
12 Step 2 we need a recurrence relation for opt(i, j) there are two cases: 1. s[i] = t[j] 2. s[i] t[j]
13 Step 2 we need a recurrence relation for opt(i, j) there are two cases: 1. s[i] = t[j] 2. s[i] t[j] let s look at case 1 if the i and j characters of s and t match, then the lcs of the strings without the ith and jth characters is one shorter than their lcs with those characters i X X X X R Z Z Z Y Y Y Y Y R Z Z Z j
14 case 2: s[i] t[j] Step 2
15 Step 2 case 2: s[i] t[j] whatever the lcs of s[0..i] and t[0..j] is, it is not true that both s[i] and t[j] are part of it (why?)
16 Step 2 case 2: s[i] t[j] whatever the lcs of s[0..i] and t[0..j] is, it is not true that both s[i] and t[j] are part of it (why?) therefore, the lcs of s[0..i] and t[0..j] must be either
17 Step 2 case 2: s[i] t[j] whatever the lcs of s[0..i] and t[0..j] is, it is not true that both s[i] and t[j] are part of it (why?) therefore, the lcs of s[0..i] and t[0..j] must be either a lcs of s[0..i 1] and t[0..j] or
18 Step 2 case 2: s[i] t[j] whatever the lcs of s[0..i] and t[0..j] is, it is not true that both s[i] and t[j] are part of it (why?) therefore, the lcs of s[0..i] and t[0..j] must be either a lcs of s[0..i 1] and t[0..j] or a lcs of s[0..i] and t[0..j 1]
19 Step 2 case 2: s[i] t[j] whatever the lcs of s[0..i] and t[0..j] is, it is not true that both s[i] and t[j] are part of it (why?) therefore, the lcs of s[0..i] and t[0..j] must be either a lcs of s[0..i 1] and t[0..j] or a lcs of s[0..i] and t[0..j 1] now there is enough information to construct a recurrence relation that defines opt(i, j)
20 Step 2 0 if i = 0 or j = 0 opt(i opt(i, j) = { 1, j 1) + 1 if s[i] = t[j] opt(i 1, j) max if s[i] t[j] opt(i, j 1)
21 Step 3 as before, put a dummy blank character onto the beginning of each string
22 Step 3 as before, put a dummy blank character onto the beginning of each string what is the shape of the memo table?
23 Step 3 as before, put a dummy blank character onto the beginning of each string what is the shape of the memo table? what does an entry in the memo matrix represent?
24 Step 3 as before, put a dummy blank character onto the beginning of each string what is the shape of the memo table? what does an entry in the memo matrix represent? what is the minimum value in the memo matrix?
25 Step 3 unsigned opt(size_t i, size_t j, Matrix<unsigned> & memo, const string & s, const string & t) { if (memo.at(i, j) == UINT_MAX) { if (i == 0 j == 0) { memo.at(i, j) = 0; } else if (s.at(i) == t.at(j)) { memo.at(i, j) = opt(i - 1, j - 1, memo, s, t) + 1; } else { memo.at(i, j) = max(opt(i, j - 1, memo, s, t), opt(i - 1, j, memo, s, t)); } } return memo.at(i, j); }
26 LCS build the LCS memo table for these two sequences: G V C E K S T G D V E G T A
27 Longest Common Subsequence an LCS matrix - G V C E K S T G D V E G T A
28 Longest Common Subsequence an LCS matrix and traceback - G V C E K S T G D V E G T A
Trigonometric Substitution
Trigonometric Substitution Alvin Lin Calculus II: August 06 - December 06 Trigonometric Substitution sin 4 (x) cos (x) dx When you have a product of sin and cos of different powers, you have three different
Slope-Intercept Formula
LESSON 7 Slope Intercept Formula LESSON 7 Slope-Intercept Formula Here are two new words that describe lines slope and intercept. The slope is given by m (a mountain has slope and starts with m), and intercept
UNIVERSITETET I OSLO
UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet Eksamen i MAT2400 Analyse 1. Eksamensdag: Onsdag 15. juni 2011. Tid for eksamen: 09.00 13.00 Oppgavesettet er på 6 sider. Vedlegg: Tillatte
Databases 1. Extended Relational Algebra
Databases 1 Extended Relational Algebra Relational Algebra What is an Algebra? Mathematical system consisting of: Operands --- variables or values from which new values can be constructed. Operators ---
Unit Relational Algebra 1 1. Relational Algebra 1. Unit 3.3
Relational Algebra 1 Unit 3.3 Unit 3.3 - Relational Algebra 1 1 Relational Algebra Relational Algebra is : the formal description of how a relational database operates the mathematics which underpin SQL
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON360/460 Samfunnsøkonomisk lønnsomhet og økonomisk politikk Exam: ECON360/460 - Resource allocation and economic policy Eksamensdag: Fredag 2. november
5 E Lesson: Solving Monohybrid Punnett Squares with Coding
5 E Lesson: Solving Monohybrid Punnett Squares with Coding Genetics Fill in the Brown colour Blank Options Hair texture A field of biology that studies heredity, or the passing of traits from parents to
UNIVERSITY OF OSLO DEPARTMENT OF ECONOMICS
UNIVERSITY OF OSLO DEPARTMENT OF ECONOMICS Postponed exam: ECON420 Mathematics 2: Calculus and linear algebra Date of exam: Tuesday, June 8, 203 Time for exam: 09:00 a.m. 2:00 noon The problem set covers
Mathematics 114Q Integration Practice Problems SOLUTIONS. = 1 8 (x2 +5x) 8 + C. [u = x 2 +5x] = 1 11 (3 x)11 + C. [u =3 x] = 2 (7x + 9)3/2
Mathematics 4Q Name: SOLUTIONS. (x + 5)(x +5x) 7 8 (x +5x) 8 + C [u x +5x]. (3 x) (3 x) + C [u 3 x] 3. 7x +9 (7x + 9)3/ [u 7x + 9] 4. x 3 ( + x 4 ) /3 3 8 ( + x4 ) /3 + C [u + x 4 ] 5. e 5x+ 5 e5x+ + C
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT BOKMÅL Eksamen i: ECON1210 - Forbruker, bedrift og marked Eksamensdag: 26.11.2013 Sensur kunngjøres: 18.12.2013 Tid for eksamen: kl. 14:30-17:30 Oppgavesettet er
Syntax/semantics - I INF 3110/ /29/2005 1
Syntax/semantics - I Program program execution Compiling/interpretation Syntax Classes of langauges Regular langauges Context-free langauges Scanning/Parsing Meta models INF 3/4-25 8/29/25 Program
Moving Objects. We need to move our objects in 3D space.
Transformations Moving Objects We need to move our objects in 3D space. Moving Objects We need to move our objects in 3D space. An object/model (box, car, building, character,... ) is defined in one position
UNIVERSITETET I OSLO
UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet Eksamen i: KJB 492 Bioinformatikk Eksamensdag: Fredag 14. desember 2001 Tid for eksamen: Kl.: 9.00 13.00 Oppgavesettet er på 7 sider. Vedlegg:
Call function of two parameters
Call function of two parameters APPLYUSER USER x fµ 1 x 2 eµ x 1 x 2 distinct e 1 0 0 v 1 1 1 e 2 1 1 v 2 2 2 2 e x 1 v 1 x 2 v 2 v APPLY f e 1 e 2 0 v 2 0 µ Evaluating function application The math demands
Exercise 1: Phase Splitter DC Operation
Exercise 1: DC Operation When you have completed this exercise, you will be able to measure dc operating voltages and currents by using a typical transistor phase splitter circuit. You will verify your
Oppgave 1a Definer følgende begreper: Nøkkel, supernøkkel og funksjonell avhengighet.
TDT445 Øving 4 Oppgave a Definer følgende begreper: Nøkkel, supernøkkel og funksjonell avhengighet. Nøkkel: Supernøkkel: Funksjonell avhengighet: Data i en database som kan unikt identifisere (et sett
UNIVERSITETET I OSLO
UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet Eksamen i INF 3230 Formell modellering og analyse av kommuniserende systemer Eksamensdag: 4. juni 2010 Tid for eksamen: 9.00 12.00 Oppgavesettet
KROPPEN LEDER STRØM. Sett en finger på hvert av kontaktpunktene på modellen. Da får du et lydsignal.
KROPPEN LEDER STRØM Sett en finger på hvert av kontaktpunktene på modellen. Da får du et lydsignal. Hva forteller dette signalet? Gå flere sammen. Ta hverandre i hendene, og la de to ytterste personene
Continuity. Subtopics
0 Cotiuity Chapter 0: Cotiuity Subtopics.0 Itroductio (Revisio). Cotiuity of a Fuctio at a Poit. Discotiuity of a Fuctio. Types of Discotiuity.4 Algebra of Cotiuous Fuctios.5 Cotiuity i a Iterval.6 Cotiuity
Exam in Quantum Mechanics (phys201), 2010, Allowed: Calculator, standard formula book and up to 5 pages of own handwritten notes.
Exam in Quantum Mechanics (phys01), 010, There are 3 problems, 1 3. Each problem has several sub problems. The number of points for each subproblem is marked. Allowed: Calculator, standard formula book
Den som gjør godt, er av Gud (Multilingual Edition)
Den som gjør godt, er av Gud (Multilingual Edition) Arne Jordly Click here if your download doesn"t start automatically Den som gjør godt, er av Gud (Multilingual Edition) Arne Jordly Den som gjør godt,
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON20/420 Matematikk 2: Matematisk analyse og lineær algebra Exam: ECON20/420 Mathematics 2: Calculus and Linear Algebra Eksamensdag: Fredag 2. mai
UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet BIOKJEMISK INSTITUTT
UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet BIOKJEMISK INSTITUTT Eksamen i: KJB492 - Bioinformatikk, 3 vekttall Eksamensdag: Onsdag 13.november 2000 Tid for eksamen: kl. 09.00-13.00
IN2010: Algoritmer og Datastrukturer Series 2
Universitetet i Oslo Institutt for Informatikk S.M. Storleer, S. Kittilsen IN2010: Algoritmer og Datastrukturer Series 2 Tema: Grafteori 1 Publisert: 02. 09. 2019 Utvalgte løsningsforslag Oppgave 1 (Fra
Neural Network. Sensors Sorter
CSC 302 1.5 Neural Networks Simple Neural Nets for Pattern Recognition 1 Apple-Banana Sorter Neural Network Sensors Sorter Apples Bananas 2 Prototype Vectors Measurement vector p = [shape, texture, weight]
UNIVERSITY OF OSLO DEPARTMENT OF ECONOMICS
UNIVERSITY OF OSLO DEPARTMENT OF ECONOMICS English Postponed exam: ECON2915 Economic growth Date of exam: 11.12.2014 Time for exam: 09:00 a.m. 12:00 noon The problem set covers 4 pages Resources allowed:
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
1 UNIVERSITETET I OSLO ØKONOMISK INSTITUTT BOKMÅL Utsatt eksamen i: ECON2915 Vekst og næringsstruktur Eksamensdag: 07.12.2012 Tid for eksamen: kl. 09:00-12:00 Oppgavesettet er på 5 sider Tillatte hjelpemidler:
FYSMEK1110 Eksamensverksted 23. Mai :15-18:00 Oppgave 1 (maks. 45 minutt)
FYSMEK1110 Eksamensverksted 23. Mai 2018 14:15-18:00 Oppgave 1 (maks. 45 minutt) Page 1 of 9 Svar, eksempler, diskusjon og gode råd fra studenter (30 min) Hva får dere poeng for? Gode råd fra forelesere
Graphs similar to strongly regular graphs
Joint work with Martin Ma aj 5th June 2014 Degree/diameter problem Denition The degree/diameter problem is the problem of nding the largest possible graph with given diameter d and given maximum degree
buildingsmart Norge seminar Gardermoen 2. september 2010 IFD sett i sammenheng med BIM og varedata
buildingsmart Norge seminar Gardermoen 2. september 2010 IFD sett i sammenheng med BIM og varedata IFD International Framework for Dictionaries Hvordan bygges en BIM? Hva kan hentes ut av BIM? Hvordan
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON320/420 Matematikk 2: Matematisk analyse og lineær algebra Exam: ECON320/420 Mathematics 2: Calculus and Linear Algebra Eksamensdag: Mandag 8. desember
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON3120/4120 Matematikk 2: Matematisk analyse og lineær algebra Exam: ECON3120/4120 Mathematics 2: Calculus and Linear Algebra Eksamensdag: Tirsdag
Physical origin of the Gouy phase shift by Simin Feng, Herbert G. Winful Opt. Lett. 26, (2001)
by Simin Feng, Herbert G. Winful Opt. Lett. 26, 485-487 (2001) http://smos.sogang.ac.r April 18, 2014 Introduction What is the Gouy phase shift? For Gaussian beam or TEM 00 mode, ( w 0 r 2 E(r, z) = E
Level Set methods. Sandra Allaart-Bruin. Level Set methods p.1/24
Level Set methods Sandra Allaart-Bruin sbruin@win.tue.nl Level Set methods p.1/24 Overview Introduction Level Set methods p.2/24 Overview Introduction Boundary Value Formulation Level Set methods p.2/24
Maple Basics. K. Cooper
Basics K. Cooper 2012 History History 1982 Macsyma/MIT 1988 Mathematica/Wolfram 1988 /Waterloo Others later History Why? Prevent silly mistakes Time Complexity Plots Generate LATEX This is the 21st century;
Quality in career guidance what, why and how? Some comments on the presentation from Deidre Hughes
Quality in career guidance what, why and how? Some comments on the presentation from Deidre Hughes Erik Hagaseth Haug Erik.haug@inn.no Twitter: @karrierevalg We have a lot of the ingredients already A
Endelig ikke-røyker for Kvinner! (Norwegian Edition)
Endelig ikke-røyker for Kvinner! (Norwegian Edition) Allen Carr Click here if your download doesn"t start automatically Endelig ikke-røyker for Kvinner! (Norwegian Edition) Allen Carr Endelig ikke-røyker
Ringvorlesung Biophysik 2016
Ringvorlesung Biophysik 2016 Born-Oppenheimer Approximation & Beyond Irene Burghardt (burghardt@chemie.uni-frankfurt.de) http://www.theochem.uni-frankfurt.de/teaching/ 1 Starting point: the molecular Hamiltonian
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON20 Forbruker, bedrift og marked, høsten 2004 Exam: ECON20 - Consumer behavior, firm behavior and markets, autumn 2004 Eksamensdag: Onsdag 24. november
Øvingsforelesning 2. Mengdelære, funksjoner, rekurrenser, osv. TMA4140 Diskret Matematikk. 10. og 12. september 2018
Mengdelære, funksjoner, rekurrenser, osv. Øvingsforelesning 2 TMA4140 Diskret Matematikk 10. og 12. september 2018 Dagens øvingsforelesning Spørsmål til emnene i forrige uke Oppgaver fra midtsemesterprøver
PATIENCE TÅLMODIGHET. Is the ability to wait for something. Det trenger vi når vi må vente på noe
CARING OMSORG Is when we show that we care about others by our actions or our words Det er når vi viser at vi bryr oss om andre med det vi sier eller gjør PATIENCE TÅLMODIGHET Is the ability to wait for
EKSAMENSOPPGAVE I SØK 1002 INNFØRING I MIKROØKONOMISK ANALYSE
Norges teknisk-naturvitenskapelige universitet Institutt for samfunnsøkonomi EKSAMENSOPPGAVE I SØK 1002 INNFØRING I MIKROØKONOMISK ANALYSE Faglig kontakt under eksamen: Hans Bonesrønning Tlf.: 9 17 64
UNIVERSITETET I OSLO
UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet Eksamen i INF 3230 Formell modellering og analyse av kommuniserende systemer Eksamensdag: 4. april 2008 Tid for eksamen: 9.00 12.00 Oppgavesettet
Dagens tema: Eksempel Klisjéer (mønstre) Tommelfingerregler
UNIVERSITETET I OSLO INF1300 Introduksjon til databaser Dagens tema: Eksempel Klisjéer (mønstre) Tommelfingerregler Institutt for informatikk Dumitru Roman 1 Eksempel (1) 1. The system shall give an overview
Andrew Gendreau, Olga Rosenbaum, Anthony Taylor, Kenneth Wong, Karl Dusen
Andrew Gendreau, Olga Rosenbaum, Anthony Taylor, Kenneth Wong, Karl Dusen The Process Goal Definition Data Collection Data Preprocessing EDA Choice of Variables Choice of Method(s) Performance Evaluation
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Bokmål Eksamen i: ECON1210 Forbruker, bedrift og marked Exam: ECON1210 Consumer Behaviour, Firm behaviour and Markets Eksamensdag: 12.12.2014 Sensur kunngjøres:
EMPIC MEDICAL. Etterutdanningskurs flyleger 21. april Lars (Lasse) Holm Prosjektleder Telefon: E-post:
EMPIC MEDICAL Etterutdanningskurs flyleger 21. april 2017 Lars (Lasse) Holm Prosjektleder Telefon: +47 976 90 799 E-post: Lrh@caa.no it-vakt@caa.no Luftfartstilsynet T: +47 75 58 50 00 F: +47 75 58 50
Emnedesign for læring: Et systemperspektiv
1 Emnedesign for læring: Et systemperspektiv v. professor, dr. philos. Vidar Gynnild Om du ønsker, kan du sette inn navn, tittel på foredraget, o.l. her. 2 In its briefest form, the paradigm that has governed
SVM and Complementary Slackness
SVM and Complementary Slackness David Rosenberg New York University February 21, 2017 David Rosenberg (New York University) DS-GA 1003 February 21, 2017 1 / 20 SVM Review: Primal and Dual Formulations
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON320/420 Matematikk 2: Matematisk analyse og lineær algebra Exam: ECON320/420 Mathematics 2: Calculus and Linear Algebra Eksamensdag: Tirsdag 7. juni
Speed Racer Theme. Theme Music: Cartoon: Charles Schultz / Jef Mallett Peanuts / Frazz. September 9, 2011 Physics 131 Prof. E. F.
September 9, 2011 Physics 131 Prof. E. F. Redish Theme Music: Speed Racer Theme Cartoon: Charles Schultz / Jef Mallett Peanuts / Frazz 1 Reading questions Are the lines on the spatial graphs representing
Issues and challenges in compilation of activity accounts
1 Issues and challenges in compilation of activity accounts London Group on environmental accounting 21st meeting 2-4 November 2015 Statistics Netherlands The Hague Kristine E. Kolshus kre@ssb.no Statistics
Level-Rebuilt B-Trees
Gerth Stølting Brodal BRICS University of Aarhus Pankaj K. Agarwal Lars Arge Jeffrey S. Vitter Center for Geometric Computing Duke University August 1998 1 B-Trees Bayer, McCreight 1972 Level 2 Level 1
Windlass Control Panel
SIDE-POWER 86-08955 Windlass Control Panel v1.0.2 Windlass Systems Installasjon manual SLEIPNER MOTOR AS P.O. Box 519 N-1612 Fredrikstad Norway Tel: +47 69 30 00 60 Fax: +47 69 30 00 70 w w w. s i d e
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Utsatt ksamen i: ECON3120/4120 Matematikk 2: Matematisk analyse og lineær algebra Postponed exam: ECON3120/4120 Mathematics 2: Calculus and linear algebra Eksamensdag:
UNIVERSITY OF OSLO DEPARTMENT OF ECONOMICS
UNIVERSITY OF OSLO DEPARTMENT OF ECONOMICS English Exam: ECON2915 Economic Growth Date of exam: 25.11.2014 Grades will be given: 16.12.2014 Time for exam: 09.00 12.00 The problem set covers 3 pages Resources
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON1910 Poverty and distribution in developing countries Exam: ECON1910 Poverty and distribution in developing countries Eksamensdag: 1. juni 2011 Sensur
The regulation requires that everyone at NTNU shall have fire drills and fire prevention courses.
1 The law The regulation requires that everyone at NTNU shall have fire drills and fire prevention courses. 2. 3 Make your self familiar with: Evacuation routes Manual fire alarms Location of fire extinguishers
0:7 0:2 0:1 0:3 0:5 0:2 0:1 0:4 0:5 P = 0:56 0:28 0:16 0:38 0:39 0:23
UTKAST ENGLISH VERSION EKSAMEN I: MOT100A STOKASTISKE PROSESSER VARIGHET: 4 TIMER DATO: 16. februar 2006 TILLATTE HJELPEMIDLER: Kalkulator; Tabeller og formler i statistikk (Tapir forlag): Rottman: Matematisk
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON3120/4120 Mathematics 2: Calculus an linear algebra Exam: ECON3120/4120 Mathematics 2: Calculus an linear algebra Eksamensag: Tirsag 3. juni 2008
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Exam: ECON320/420 Mathematics 2: Calculus and Linear Algebra Eksamen i: ECON320/420 Matematikk 2: Matematisk analyse og lineær algebra Date of exam: Friday, May
Kneser hypergraphs. May 21th, CERMICS, Optimisation et Systèmes
Kneser hypergraphs Frédéric Meunier May 21th, 2015 CERMICS, Optimisation et Systèmes Kneser hypergraphs m, l, r three integers s.t. m rl. Kneser hypergraph KG r (m, l): V (KG r (m, l)) = ( [m]) l { E(KG
Verifiable Secret-Sharing Schemes
Aarhus University Verifiable Secret-Sharing Schemes Irene Giacomelli joint work with Ivan Damgård, Bernardo David and Jesper B. Nielsen Aalborg, 30th June 2014 Verifiable Secret-Sharing Schemes Aalborg,
HØGSKOLEN I NARVIK - SIVILINGENIØRUTDANNINGEN
HØGSKOLEN I NARVIK - SIVILINGENIØRUTDANNINGEN EKSAMEN I FAGET STE 6243 MODERNE MATERIALER KLASSE: 5ID DATO: 7 Oktober 2005 TID: 900-200, 3 timer ANTALL SIDER: 7 (inklusiv Appendix: tabell og formler) TILLATTE
Vekeplan 4. Trinn. Måndag Tysdag Onsdag Torsdag Fredag AB CD AB CD AB CD AB CD AB CD. Norsk Matte Symjing Ute Norsk Matte M&H Norsk
Vekeplan 4. Trinn Veke 39 40 Namn: Måndag Tysdag Onsdag Torsdag Fredag AB CD AB CD AB CD AB CD AB CD Norsk Engelsk M& Mitt val Engelsk Matte Norsk Matte felles Engelsk M& Mitt val Engelsk Norsk M& Matte
Gir vi de resterende 2 oppgavene til én prosess vil alle sitte å vente på de to potensielt tidskrevende prosessene.
Figure over viser 5 arbeidsoppgaver som hver tar 0 miutter å utføre av e arbeider. (E oppgave ka ku utføres av é arbeider.) Hver pil i figure betyr at oppgave som blir pekt på ikke ka starte før oppgave
Universitetet i Bergen Det matematisk-naturvitenskapelige fakultet Eksamen i emnet Mat131 - Differensiallikningar I Onsdag 25. mai 2016, kl.
1 MAT131 Bokmål Universitetet i Bergen Det matematisk-naturvitenskapelige fakultet Eksamen i emnet Mat131 - Differensiallikningar I Onsdag 25. mai 2016, kl. 09-14 Oppgavesettet er 4 oppgaver fordelt på
Brukerdokumentasjon Brukerdokumentasjon
Brukerdokumentasjon Brukerdokumentasjon 2 Brukerveiledning For en som skal ta en test: For den som skal ta en test er det mening at en bruksanvisning skal være unødvendig. De få informasjonene som en bruker
3/1/2011. I dag. Recursive descent parser. Problem for RD-parser: Top Down Space. Jan Tore Lønning & Stephan Oepen
INF2820 Datalingvistikk V2011 TABELLPARSING Jan Tore Lønning & Stephan Oepen 1. mars 2011 2 I dag Oppsummering fra sist: Recursive-descent og Shift-reduce parser Svakheter med disse Tabellparsing: Dynamisk
NTNU, TRONDHEIM Norges teknisk-naturvitenskapelige universitet Institutt for sosiologi og statsvitenskap
NTNU, TRONDHEIM Norges teknisk-naturvitenskapelige universitet Institutt for sosiologi og statsvitenskap EKSAMENSOPPGAVE I SVPOL 105 Komparativ og Internasjonal Politikk Eksamensdato: 28.11.01 Eksamenstid:
INF2820 Datalingvistikk V2011. Jan Tore Lønning & Stephan Oepen
INF2820 Datalingvistikk V2011 Jan Tore Lønning & Stephan Oepen TABELLPARSING 1. mars 2011 2 I dag Oppsummering fra sist: Recursive-descent og Shift-reduce parser Svakheter med disse Tabellparsing: Dynamisk
EN Skriving for kommunikasjon og tenkning
EN-435 1 Skriving for kommunikasjon og tenkning Oppgaver Oppgavetype Vurdering 1 EN-435 16/12-15 Introduction Flervalg Automatisk poengsum 2 EN-435 16/12-15 Task 1 Skriveoppgave Manuell poengsum 3 EN-435
TEKSTER PH.D.-KANDIDATER FREMDRIFTSRAPPORTERING
TEKSTER PH.D.-KANDIDATER FREMDRIFTSRAPPORTERING DISTRIBUSJONS-E-POST TIL ALLE KANDIDATER: (Fornavn, etternavn) Den årlige fremdriftsrapporteringen er et viktig tiltak som gjør instituttene og fakultetene
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON3610/4610 Samfunnsøkonomisk lønnsomhet og økonomisk politikk Exam: ECON3610/4610 Resource Allocation and Economic Policy Eksamensdag: Torsday 28.
Hvor mye teoretisk kunnskap har du tilegnet deg på dette emnet? (1 = ingen, 5 = mye)
INF234 Er du? Er du? - Annet Hvor mye teoretisk kunnskap har du tilegnet deg på dette emnet? (1 = ingen, 5 = mye) Hvor mye praktisk kunnskap har du tilegnet deg på dette emnet? (1 = ingen, 5 = mye) Hvor
Tips for bruk av BVAS og VDI i oppfølging av pasienter med vaskulitt. Wenche Koldingsnes
Tips for bruk av BVAS og VDI i oppfølging av pasienter med vaskulitt Wenche Koldingsnes Skåring av sykdomsaktivitet og skade I oppfølging av pasienter med vaskulitt er vurdering og konklusjon vedr. sykdomsaktivitet
Prosjektet Digital kontaktinformasjon og fullmakter for virksomheter Digital contact information and mandates for entities
Prosjektet Digital kontaktinformasjon og fullmakter for virksomheter Digital contact information and mandates for entities Nordisk Adressemøte / Nordic Address Forum, Stockholm 9-10 May 2017 Elin Strandheim,
stjerneponcho for voksne star poncho for grown ups
stjerneponcho for voksne star poncho for grown ups www.pickles.no / shop.pickles.no NORSK Størrelser XS (S) M (L) Garn Pickles Pure Alpaca 300 (350) 400 (400) g hovedfarge 100 (100) 150 (150) g hver av
Stationary Phase Monte Carlo Methods
Stationary Phase Monte Carlo Methods Daniel Doro Ferrante G. S. Guralnik, J. D. Doll and D. Sabo HET Physics Dept, Brown University, USA. danieldf@het.brown.edu www.het.brown.edu Introduction: Motivations
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON30/40 Matematikk : Matematisk analyse og lineær algebra Exam: ECON30/40 Mathematics : Calculus and Linear Algebra Eksamensdag: Tirsdag 0. desember
Dialogkveld 03. mars 2016. Mobbing i barnehagen
Dialogkveld 03. mars 2016 Mobbing i barnehagen Discussion evening March 3rd 2016 Bullying at kindergarten Mobbing i barnehagen Kan vi si at det eksisterer mobbing i barnehagen? Er barnehagebarn i stand
UNIVERSITETET I OSLO
UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet Eksamen i INF 3230 Formell modellering og analyse av kommuniserende systemer Eksamensdag: 8. juni 2012 Tid for eksamen: 9.00 13.00 Oppgavesettet
Kartleggingsskjema / Survey
Kartleggingsskjema / Survey 1. Informasjon om opphold i Norge / Information on resident permit in Norway Hvilken oppholdstillatelse har du i Norge? / What residence permit do you have in Norway? YES No
Medisinsk statistikk, KLH3004 Dmf, NTNU 2009. Styrke- og utvalgsberegning
Styrke- og utvalgsberegning Geir Jacobsen, ISM Sample size and Power calculations The essential question in any trial/analysis: How many patients/persons/observations do I need? Sample size (an example)
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON320/420 Matematikk 2: Matematisk analyse og lineær algebra Exam: ECON320/420 Mathematics 2: Calculus and Linear Algebra Eksamensdag: Onsdag 6. desember
Public roadmap for information management, governance and exchange. 2015-09-15 SINTEF david.norheim@brreg.no
Public roadmap for information management, governance and exchange 2015-09-15 SINTEF david.norheim@brreg.no Skate Skate (governance and coordination of services in egovernment) is a strategic cooperation
Gradient. Masahiro Yamamoto. last update on February 29, 2012 (1) (2) (3) (4) (5)
Gradient Masahiro Yamamoto last update on February 9, 0 definition of grad The gradient of the scalar function φr) is defined by gradφ = φr) = i φ x + j φ y + k φ ) φ= φ=0 ) ) 3) 4) 5) uphill contour downhill
Eksamen SOS1001, vår 2017
Eksamen SOS1001, vår 2017 BOKMÅL Oppgave 1, 2 og 3 teller likt (33,3 %) i karaktervurderingen. Hver enkelt oppgave må bestås for å bestå eksamen i sin helhet. Merk at alle oppgavene kan besvares kort (ca.
Hvordan føre reiseregninger i Unit4 Business World Forfatter:
Hvordan føre reiseregninger i Unit4 Business World Forfatter: dag.syversen@unit4.com Denne e-guiden beskriver hvordan du registrerer en reiseregning med ulike typer utlegg. 1. Introduksjon 2. Åpne vinduet
HONSEL process monitoring
6 DMSD has stood for process monitoring in fastening technology for more than 25 years. HONSEL re- rivet processing back in 990. DMSD 2G has been continuously improved and optimised since this time. All
How Bridges Work Sgrad 2001
How Bridges Work Sgrad 2001 The Basic s There are three major types of bridges: The beam bridge The arch bridge The suspension bridge prepared by Mr.S.Grad 2 The biggest difference between the three is
Økologisk og kulturell dannelse i økonomiutdanningen
Økologisk og kulturell dannelse i økonomiutdanningen Dannelse på norsk fra ord til handling Professor Ove Jakobsen HHB/UiN Frihet med ansvar Om høyere utdanning og forskning i Norge NOU 2000:14 Det er
SAS FANS NYTT & NYTTIG FRA VERKTØYKASSA TIL SAS 4. MARS 2014, MIKKEL SØRHEIM
SAS FANS NYTT & NYTTIG FRA VERKTØYKASSA TIL SAS 4. MARS 2014, MIKKEL SØRHEIM 2 TEMA 1 MULTIPROSESSERING MED DATASTEGET Multiprosessering har lenge vært et tema i SAS Stadig ny funksjonalitet er med på
GYRO MED SYKKELHJUL. Forsøk å tippe og vri på hjulet. Hva kjenner du? Hvorfor oppfører hjulet seg slik, og hva er egentlig en gyro?
GYRO MED SYKKELHJUL Hold i håndtaket på hjulet. Sett fart på hjulet og hold det opp. Det er lettest om du sjølv holder i håndtakene og får en venn til å snurre hjulet rundt. Forsøk å tippe og vri på hjulet.
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT
UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Utsatt eksamen i: ECON1410 - Internasjonal økonomi Exam: ECON1410 - International economics Eksamensdag: 18.06.2013 Date of exam: 18.06.2013 Tid for eksamen: kl.
TFY4170 Fysikk 2 Justin Wells
TFY4170 Fysikk 2 Justin Wells Forelesning 5: Wave Physics Interference, Diffraction, Young s double slit, many slits. Mansfield & O Sullivan: 12.6, 12.7, 19.4,19.5 Waves! Wave phenomena! Wave equation
Til styrets medlemmer: Torkjel Solbakken, Jo Agnar Hansen, Rune Landås Gjeterhundrådgiver/sekretær: Cathinka Kjelstrup Kopi til: Arne Loftsgarden
Til styrets medlemmer: Torkjel Solbakken, Jo Agnar Hansen, Rune Landås Gjeterhundrådgiver/sekretær: Cathinka Kjelstrup Kopi til: Arne Loftsgarden Bærum, 1. november 2014 Referat telefonmøte torsdag 27.
Molare forsterkningsbetingelser
Molare forsterkningsbetingelser Hva er mekanismen(e) bak forsterkning? Hvor langt opp eller ned skal man skru mikroskopet for å se godt nok? Kjetil Viken 1 2 ARBEIDSDAG sitte ved pc formelle samtaler møter
Supplemental Information
Supplemental Information Figure S1. 2D gel electrophoresis of ipt-transgenic broccoli at harvesting and after cooking. Protein composition of ipt-transgenic broccoli lines 102 and 103 and non-transgenic
Fra sekvensielt til parallelt
Fra sekvensielt til parallelt «Sanntidprogrammering etter 33 år» Øyvind Teig senior utviklingsingeniør Autronica Fire and Security, «a UTC company» Gjesteforelesning på Høgskolen i Sør-Trøndelag (HiST)