Save this PDF as:

Størrelse: px
Begynne med side:




2 Innholdsfortegnelse- Del1:Verdensmilitæreforbruk Hvaermilitærtforbruk?.side3 Generelletrenderi2016.side4 Verdensmilitæreforbrukperregion.side4 Verdensforsvarsbudsjettfra2015til2016.side11 Del2:Verdensvåpenflyt Overordnetomutviklingen2012til2016.side14 Destørstevåpeneksportøreneogderesviktigstemarkeder.side15 Destørstevåpenimportøreneogderesviktigsteleverandører.side16 - Del3:Implikasjoneravmilitærtforbruk Denmilitærebyrde.side18 Spenningogopprustning.side20 Militariseringavsamfunnet.side21 Vedlegg:Landinndelingperregion.side24-1

3 2 Innledning- Dennerapportentarforsegverdensmilitæreforbruki2016.Fordenne rapportensformålinkludererdetbådestørrelsenpåforsvarsbudsjetter,litt videredefinertmilitærtforbruk,eksportogimportavvåpen,samtmilitarisering avsamfunn.viprøveråbådevisetrenderoverdesisteårenesutvikling,samtå gietbildepåhvordansituasjonenerforøyeblikket.rapporten,somerfinansiert medstøttefranorad,skalbidratilformidlingavrelevantogaktuellforskning rundttemaersomopprustningogdeutviklingsmessigekonsekvenseneav militariseringavsamfunnet. I2015såvi,forførstegangsiden2011,enøkningidetglobalemilitære forbruket,ogdennetrendenvedvartei2016,tiltrossforfortsattlaveoljepriser ogøkonomiskvanskeligheterimangeland.vedvarendeøkonomiskeproblemer kanbidratilenframtidigreduksjonavmilitæreutgifter,mentiltrossfor kriselignendetendenserimangelandøktealtsådemilitæreutgifteneifjor. Andrefaktorer,foreksempeltrusselvurderinger,kanaltsåvisesegåblilike viktigeellerviktigere.medøkendespenningsnivåmellomrusslandognato,på Koreahalvøya,ogiSørMkinahavet,samtkonflikteriMidtøsten,kanmedføre fortsattopprustningimangeland. Denglobalevåpenflytenvarogsåi2016pregetavoverføringerfralandi nordligedeleravverdentillandidetglobalesør.dennetrendenharblitttydelig iløpetavdesisteårene,medlandpådennordligehalvkulesomstore eksportørertilkunderlengersør.vedvartedermedvedvartetrendensomhar blitttydeligdesenesteårene,nemligensterkeregradavoverføringerfradet globalenordtildetglobalesør.usaer,somitidligereår,denubestridte eksportvinneren,menshalvpartenavdestørstevåpenimportøreneerlandi Asia/Oseania. Del1:Verdensmilitære(forbruk Deterikkealltidenstatsmilitæreutgiftersamsvarermedpengeneavsattover forsvarsbudsjettet.detkommertydeligframidennerapporten,hvortallenefor militærtforbrukpresentertavstockholminternationalpeaceresearchinstitute (SIPRI)ikkealltidtilsvarertalleneioversiktenoverforsvarsbudsjettene publisertavinternationalinstitutefor StrategicStudies(IISS).Såhvainngåregentligi betegnelsenmilitærtforbruk? Hvordan-beregnes-det-militære- forbruk?- Enklestsett,kanmandefinereenstats militæreforbruksomdemidlersomeravsatt overstatensforsvarsbudsjett.itilleggtildisse Militærstrukturinkluderer: KLandetsvæpnedestyrker, inkludertfredsbevarendest yrker KForsvarsdepartementogandre statligeorgansomerengasjerti militæraktivitet KParamilitærestyrker,nårdisseer trentogutstyrtformilitære operasjoner KMilitæreromprogram

4 rene forsvarsutgiftenevelgermanofteogsååinkluderesivileutgifterpå statsbudsjettenesomeravgjørendeforåopprettholdedenmilitærestrukturen. Enpraktisktilnærmingtilkartleggingavmilitærtforbrukbørinkluderebåde faktiskebevilgningertilmilitærstrukturogkapitalkostnaderavdennemilitære strukturen.etlandsmilitærestrukturinkluderersometminimumelementenei tekstboksentilhøyre. Videremåmansepåhvilketypeaktiviteterdenmilitærestrukturenleggertil rettefor.itilleggtilgrunnstrukturenitekstboksenover,børvidermedogså inkludereutgiftertilfølgendeaktiviteteridetmilitæreforbruk: 1. Anskaffelseogvedlikeholdavmilitærtmateriell. 2. Utgiftertilmilitærtogsiviltpersonell.Detteinkludererbådelønnog pensjontilmilitærtpersonell,menogsåsosialeutgiftertilsliktpersonelli tjeneste. 3. Direkteutgiftertilallemilitæreoperasjoner,dertillogistikkogsivile beredskapskostnader. 4. Militærforskningogutvikling.Imangelandliggerhoveddelenavdisse utgifteneinnenfordesivileuniversitetskogforskningsbudsjettene. 5. Militærbistand.Dettebetyrdaatverdienavdenmilitærebistandenmå inngåidonorlandetsmilitæreforbruk. 6. Utgiftertilsivilforsvar/sivilkriseberedskapitilfellemilitærkonflikt. 7. Faktiskeutgifterforavsluttetmilitæraktivitet. 8. Veteranutgifter,støttetilmilitæremuseerogtilsvarendemilitærKkulturelle bevilgninger. 9. Utgiftertildemobiliseringogavvæpning. 10. Utgiftertilnedrustning,våpendestruksjonogdertilmonitorering. Enavdemestomfattendemåteneåmåleverdensmilitæreforbrukpåglobalter utvikletavsipri.deresmetodeinkludererkundeførstefemkategorierav militæraktivitetsomlistetover,ogikkedesistefem.siprimstatistikkenerlikevel denmestomfattendeglobalemålestokkenformilitærtforbruktilgjengelig,og utgjørderfordennerapportensutgangspunkt. ItilleggtilSIPRIMstatistikkenforverdensmilitæreforbruki tardenne rapportenogsåforsegverdensforsvarsbudsjetteri2015,samtulikelandsgrad avmilitarisering.kildegrunnlagetforsistnevnteer TheMilitaryBalance2017, enårbokutgittavtheinternationalinstituteforstrategicstudies(iiss),samt BonnInternationalCenterforConversion(BICC)årligeGlobalMilitarization Index. 2 1https://

5 4 - Overordnet-om-verdens-militære-forbruk-i TallpublisertavSIPRIiapril2017viseretglobaltmilitærtforbrukpånesten 1,686billioneri2016,2,2%avverdenssamledeBNP.Detterepresentereren beskjedenøkningpåomtrent0,4%sammenlignetmed2015,ogøkningenfra foregåendeårfortsetterdermed.2015varforøvrigdetførsteåretmedøkte militæreutgiftersiden2011. FortsattutmerkerUSAsegsomlandetiverdenmedklarthøyestmilitært forbruk,fulgtavkina,russland,saudimarabia,ogindia.forførstegangsiden 2011hardetamerikanskemilitæreforbruketgåttopp,mensforbruketiVestM, SentralM,ogØstMEuropaharfortsattåstigeitaktmedspenningsnivåetmellom RusslandogNATO.MilitæreutgifterfortsetterogsååstigeiAsiaogOseania, spesieltsørmogsentralmasia,mensmangeoljerikeland,somangola,irak,oman ogsaudimarabia,harhattetredusertforbruk.deterimidlertidnoen oljeeksportørersomøkersittmilitæreforbruk,blantdemnorge. ForbruketiAfrikaogSørMogSentralMAmerikaogKaribiahargåttnedsiden forrigefemårsperiode. De15størsteforbrukernestårfor81%avdetsamledeforbruket,ogblantdisse erdetkina(118%),russland(87%)ogindia(54%)somharhattdenstørste økningenmellom2007og2016. Denstørsteøkningiforbrukiperioden2007M2016finnerviiNiger(277%); Gambia(249%til2015);Mali(228%);Kambodsja(202%);ogRepublikken Kongo(195%).DenstørstenedgangenisammeperiodefinnerviiEkvatorialM Guinea(M92%);Venezuela(M85%);Georgia(M68%);SørMSudan(M55%);ogFiji(M 44%). Verdens-militære-forbruk-per-region- SIPRIsoversiktoverdetglobalemilitæreforbruketviserstoreregionale variasjoner.mangeavdesammelandenegårigjensommilitærestorforbrukere omvisammenlignermedtidligereår,samtidigsomendringerinoenlandbidrar tilåidentifisereviktigeutviklingstrekk. Region Endring Defem største militære forbrukere Statermedbetydeligeendringeri sittmilitæreforbruk Afrika Svak nedgang 1.Algerie 2.Marokko 3.SørMAfrika 4.Angola 5.Sudan Økt:Botswana,Mali,Chad,Senegal Redusert:SørMSudan,Elfenbenskysten, Ghana Amerika Svak nedgang 1.USA 2.Brasil Økt:Argentina

6 5 3.Canada 4.Colombia 5.Venezuela Redusert:Venezuela,Ecuador,Peru, Mexico Midtøsten Usikkert 1.SaudiArabia 2.UAE 3.Israel 4.Tyrkia 5.Iran Økt:Iran,Kuwait Redusert:Irak,SaudiMArabia Asiaog Oseania Moderat vekst 1.Kina 2.Japan 3.India 4.SørKorea 5.Australia Økt:Filippinene Redusert:M Europa Moderat vekst 1.Russland 2.Frankrike 3.Storbritannia 4.Tyskland 5.Italia Økt:Latvia,Litauen,Bulgaria,Ungarn, Italia Redusert:Aserbajdsjan Regionenes-andel-av-verdens-militære-forbruk NordM Amerika,37 LatinMAmerikaog Karibia,3 AsiaogOseania, 27 Afrika,2 Europa,20 Midtøsten,11

7 Regionenes-militære-forbruk-i-milliarder-dollar ,3 38 NordAmerika Asiaog Oseania Europa Midtøsten LatinMAmerika ogkaribia TalletforMidtøstenerfra2015,daSIPRImanglerdatafor2016. Afrika Afrika- NedgangenidetmilitæreforbruketfortsatteiAfrikai2016,medenreduksjon på1,3%tilrettiunderkantav38milliarder.detteandreåretmednedgang kommerettermerennettiårsvekst,ogforbruketliggerfortsatt48%over nivåetfra2007. IAfrikasørforSaharaharforbruketgåttnedmed3,6%,blantannetdrevetav reduksjonilandsomsørmsudan(54%)ogangola(10%).regionenerpregetav flerepågåendekonflikter,menøkningenidetmilitæreforbruketi konfliktrammedelandvarlikevellavereenntidligereår.botswanasforbrukgikk oppmed40%fra2015m2016,ogdetteerdenstørsteøkningeniafrika. DetmilitæreforbruketfortsatteimidlertidåstigeiNordMAfrika,selvomveksten ialgerie,kontinentetsstørstemilitæreforbruker,ikkevarlikehøysomtidligere år.dettevarblantannetforårsaketavhøyeoljepriser.marokkoharnåafrikas nesthøyestemilitæreforbruk,ogdetspenteforholdetmellomdetolandenehar førttilensituasjonsombegynneråseutsometrustningskappløp. LatinBAmerika-og-Karibia- LatinMAmerikaogKaribiaopplevdeenmarkantreduksjonimilitæreutgifteri 2016,ogendtetotaltpåetforbrukpå66,6milliarder.Nedgangenpå9,1%i KaribiaogSentralMAmerikaerførstogfremstetresultatetavlavere forsvarsbudsjetterimexico,somdesisteåreneharrustetoppmilitærtforkrigen motlandetsnarkotikakarteller. 6

8 SørMAmerikasmilitæreforbrukgikknedmed7,5%,hvilketblantannetskyldes økonomiskeproblemerilandsomvenezuela,ecuador,peruogbrasil.samtidig økteforbruketiargentinaogcolombia. Midtøsten- PågrunnavmanglendedatapublisererSIPRIihellerikkeiårnoenregional oversiktovermidtøsten.deterspesieltmanglendetallmaterialefralibanon, Qatar,Syria,DeforentearabiskeemiraterogJemensomgjørarbeidetmedå settesammenenoversiktvanskelig.pågrunnlagavdeninformasjonensom foreliggerantydesdetenreduksjonidetmilitæreforbruketimidtøstenpå17%. DetmilitæreforbruketilandsomSaudiMArabiaogIrakhargåttned,myepå grunnavlaveoljepriser,mensiransforbrukharøktettersomdeinternasjonale sanksjonenemotlandetharblittløftet. Asia-og-Oseania- DetmilitæreforbruketiAsiafortsatteåstigei2016,til450milliarder.Detteer enøkningpå4,6%sammenlignetmedåretfør,enlittlaverevekstenntidligere år.årsakentildetteeratkinasmilitæreforbrukharbremsetitaktmedden økonomiskevekstenilandet.sentralmogsørmasiaharhattdenstørsteveksteni forholdtil2015,mensiettiårsperspektiverdetøstmasiasomharhattden størsteveksten,med74%.fra2007til2016øktedetmilitæreforbruketialle landiasiaogoseaniabortsettfra3. Femavverdens15størsteforbrukereeriAsiaogOseania;Kina,India,Japan, SørMKoreaogAustralia.RegionaltstårKinafor48%avdetmilitæreforbruket, nesten4gangerhøyereennindia,somfølgerpåplassenetter. Deterflerekildertilspenningsomkanbidratilåforklareøkningenimilitært forbrukiregionenoverdetsistetiåret.itilleggtilspenningenmellomindiaog Pakistan,IndiaogKina,ogpåKoreaMhalvøya,finnerviterritorielledisputtersom involvererkinaogjapaniøstmkinahavet,ogkina,vietnam,filippinene, IndonesiaogMalaysiaiSørMkinahavet.Filippinenevarblantlandenemedden høyesteøkningenimilitærtforbrukfra2015til2016. Europa-og-NordBAmerika- DetmilitæreforbruketiEuropastegmed2,8%fra2015til2016,til334 milliarder.forbruketøktebådeivestm,østm,ogsentralmeuropa,medhenholdsvis 2,6%,3,5%,og2,4%. Frankrike,Storbritannia,TysklandogItaliaeralleblantde15landeneiverden medhøyestmilitærtforbruk,oghersåvispesieltenhøyøkningiforbruketi Italia. SentralMEuropaerpregetavenfryktforetmilitærtsterktRussland,ogLatviaer landetiverdenmeddenstørsteøkningenimilitærtforbrukfra2015til2016.i tilleggserviensterkøkningilitauen. 7

9 IØstMEuropaerdetførstogfremstRusslandsomtrekkeroppnivået.Landetøkte sinemilitæreutgiftermed5,9%fra2015,tiltrossforøkonomiske vanskeligheter.iutgangspunktetskullelandetsmilitæreutgifterned,men myndighetenebestemtesegforåbetaleendeluteståendegjeldtilrussiske produsentermotsluttenav2016.utendennebetalingenvillerussiskmilitært forbrukhablittredusertmed12%. Norgeøktesinemilitæreutgifterfra46,8milliarderkroneri2015til50,3 milliarderkroneri2016.medetmilitærtforbruksomtilsvarer1,6%avbnpog 3,2%avoffentligeutgifterliggerNorgesforbrukunderlandsomFrankrikeog Storbritannia,mensamtidiggodtovernivåetivårenabolandSverigeog Danmark.Dersomviserpåmilitærtforbrukpr.innbyggerliggerNorgei verdenstoppen,medetforbrukpå1138pr.innbygger.utifrasipris tallmaterialeplassererviossdasomnummer7iverden,etterisrael,saudim Arabia,Oman,Singapore,USAogKuwait.Daerimidlertidendellandutelattpå grunnavmanglendedata. USAogCanadastårsamletfor90%avdetmilitæreforbruketiAmerika,ogviste enmarginaløkningfra2015.usavarfortsattdetlandetiverdenmedklart høyestmilitærtforbruk,på611milliarder.detteforbruketgikki2016oppfor førstegangsiden2010,ogeromtrent1/3avdettotaleglobaleforbruket,nesten 3gangersåhøytsomnestelandpålisten,Kina. Statene-med-størst-militært-forbruk-i-2016,-oppgitt-i-milliarder-USD: ,2 63,7 55,9 55,7 48,3 46,1 41,1 36,8 27,9 24,6 23,7 22,

10 De-femten-landene-med-størst-militært-forbruk-som-%-andel-av-statens-BNP- 12,00% 10,00% 10,00% 8,00% 6,00% 5,30% 5,70%5,80% 4,00% 2,00% 3,30% 1,90% 2,50% 2,70% 2,30%1,90% 1,50% 2,00% 1,00% 1% 1,30% 0,00% Våpensystemers-økende-kostnader- Tunge,avansertevåpensystemereroftesværtkostbare,menitilleggtil innkjøpsprisenkommerandrekostnader.deternoenvåpensystemersomtrolig kommertilåpregemangelandsmilitæreforbrukiflereårframover.etsystem somharblittmyeomtaltdetsisteåreterusaspåbegynterakettskjold,somblant annetskalbeståavmissilbaserogradarstasjoner,angiveligsometforsvarmot missilerframidtøsten.imidlertidanserrusslandsystemetsominnrettetmot russiskemissiler,oghartruetmedatmissilforsvaretvilmedførebehovfor ytterligereopprustningfrarussiskside. Rakettskjoldetskalbeståav44missilbaser,blantannetiRomaniaogPolen,og radarstasjoner.undersintidsompresidentpumpetgeorgew.bush66 milliarderinniutviklingenavsystemet,ogbarackobama,somovertok programmet,brukteinntilmidtenav201548milliarderpådenvidere utviklingen.systemeterennåikkeferdigutviklet,ogdeteruklarthvadentotale prislappenblir,menenrapportfrausasgovernmentaccountabilityofficei 2014antydetatutviklingenavsystemetframtil2018villekosteminst22 milliarder. 3 Detsomerklarteratprisenkommertilåblihøy,ogtestersålangt viseratdedeleneavsystemetsomeretablertikkeharfungertspesielt tilfredsstillende. EnforventetkonsekvensavdenneutbyggingeneraltsåatRusslandutvikler missilersompåulikemåterkanomgårakettskjoldet,somviltvingeusatilå brukemerpengerpåetoppgradertrakettskjold. Mangeland,inkludertNorge,haravtaltkjøpavjagerflyetFM35A,ogdette kommertilåpåvirkemilitæreutgifterilangtidframover.ennyligjusteringav utviklingskostnadenetilflyetredusertedenoffisielleprisenforetferdigflytil 3 9

11 under100millioner.denamerikanskekongressenharimidlertidsattavnesten 120millionertilhvertfly.Detteerdenbilligstevarianten.MarineCorps FM35B ogmarinensfm35charproduksjonskostnaderpåhenholdsvis166,4og185,2 millioner. 4 Detteerkuninnkjøpsprisen,oginkludererikkekostnadertilsystemM oppdateringer,driftoglagring,somvilværeformidable.beregningerfrausa viseratbrukenavfm35ai2016kostetmerenn44000pr.timeiluften,merenn dobbeltsåmyesomforenfm16.detinkludererhellerikkeprisenforvidere testingogforbedringavmanglerogfeilfunnetundernyligutførtetester.flyene måitilleggmoderniseresogoppdateres,noesomtroligvilkosterundt3 milliarderoverdenesteseksårene. 5 OverheleprosjektetslevetiderdetforventetatUSAvilbruke1,5billionerpåå utvikle,byggeogvedlikeholde2500fm35jagerfly stumble.html#price_tag_is_the_only_thing_stealthy 10

12 Verdens-forsvarsbudsjetter-i Etterennedgangiverdenssamledeforsvarsbudsjetteri2015såvienfortsatt reduksjoni2016med0,4%.detteerførstogfremstforårsaketavreduserte forsvarsbudsjetterimidtøsten,selvomvekstiflereasiatiskelandbidrotilå dempedentotalereduksjonen.spenningenpåkoreamhalvøyaogkonfliktenisørm kinahaveterblantfaktorenesombidrartildette. Russlandsforsvarsbudsjetterharogsågåttned,myegrunnetøkonomiske vanskeligheter,ogflereframtidigekuttharblittannonsert.landetsøkonomihar stabilisertsegetterdenalvorligenedgangeni2014m2015,selvomnedgangen hellerikkei2016varsnuddtilvekst.laveoljepriser,vestligesanksjonerog behovetforåerstatteukrainasomleverandøravkomponenterog undersystemerharlagtpresspåforsvarssektoren.myndigheteneønskerderfor åkutteiforsvarsbudsjettet,ogdetgårspesielthardtutovermilitærforskningog utvikling. IEuropafortsatteøkningenavforsvarsbudsjettenesomstarteti2015,omenni littlaveretempo.øktspenningmellomnatoogrussland,terrorangrepimange europeiskeland,ogetfortsattønskeomåinvolveresegmilitærtimidtøsten bidrotilvekstibudsjettene. USAsubestridteposisjonpåtoppenavlistenoververdensforsvarsbudsjetter vedvarte,ogforsprangetnedtilnummerto,kina,harøktsammenlignetmed De-15-største-forsvarsbudsjettene-i-2016,-målt-i-milliarder-dollar: ,5 145,8 58,9 56,9 52,5 51,1 47,3 47,2 38,3 33,8 24,2 23,5 22, ,1 7 Alledatafremstiltomendringeristatersforsvarsbudsjettidennerapportenerhentetfra The MilitaryBalance2017,utgittavdeTheInternationalInstituteforStrategicStudies,februar

13 12 Fra2015til2016komenstordelavdenglobaleøkningeniforsvarsbudsjetteri USA,KinaogIndia.SamtidigvardetogsåenøkningilandsomTyskland,Italiaog Iran.PådenandresidenreduserteSaudiMArabia,Russland,Storbritannia, VenezuelaogAngolasineforsvarsbudsjetter. Regional-fordeling-av-verdens-utgifter-til-forsvarsbudsjetter-for-2016:- Sammenlignetmed2015harNordMAmerika,EuropaogAsia/Australasiai2016 øktsineandeleravverdensforsvarsbudsjetter,omennrelativtbeskjedent,mens MidtøstenogLatinMAmerikaharredusertsineandeler. Reduksjoner-i-forsvarsbudsjett-fordeler-seg-andelsmessig-som-følger:-- NordAmerika 40% Europa 16% Russlandog Eurasia 4% Asiaog Australasia 24% Midtøstenog NordAfrika 11% LatinMAmerika 4% Afrikasør forsahara 1% SaudiMArabia 57% Russland 15% Venezuela 3% Storbritannia 2% Brasil 3% Mexico 1% Angola 3% SørMSudan 1% Andre 10% Spania 3% Polen 2%

14 13 DetvariallhovedsakSaudiMArabiaogRusslandsomredusertesineforsvarsM budsjetterfra2015til2016. Økninger-i-verdens-forsvarsbudsjett-fordeler-seg-andelsmessig-som-følger:-- DeteraltsåKina,IndiaogUSAsomstårfordenklarthøyesteandelenav økningeniverdensforsvarsbudsjetteri2016. Del2:Verdens'våpenflyt 8 SIPRIopprettholderendatabaseoverkjøp,salgogdonasjoneravstore konvensjonellevåpenmellomstater,internasjonaleorganisasjonerogikkem statligeaktører.siprivektleggerimyeavsittarbeidtrenderovertid,og presenterermyetallmaterialeforfemårsperioder.internasjonalvåpenhandeler gjernepregetavstorevareleveranseroverflereår,ogdettekangistoreårlige variasjoneriimportmogeksportvolum.flerårigstatistikkgirdermedetriktigere bildeavtrenderideninternasjonalevåpenhandelen.databaseninneholder imidlertidogsåtallforenkeltår. Forperioden2012M2016harSIPRIidentifisert57landsomstoreeksportørerav våpen,og155landsomimportøreravstorekonvensjonellevåpen. 8OpplysningenebenyttetidennedelenerhentetfraSIPRIsoversiktoververdens våpenoverføringer,tilgjengeligpå internationalmarmsmtransfersm2016.pdf Kina 21% India 18% ØvrigeAsia 6% USA 18% Australia 5% SørMKorea 2% Singapore 2% Andre 9% Iran 5% ØvrigeEuropa 7% Tyskland 3% Italia 2% Tyrkia 2%

15 Overordnet-om-utviklingen-2012-til Iforholdtilfemårsperiodenmellom2007og2011,hardetiperioden2012M2016 værtenøkningioverføringeravvåpenpå8,4%.dettegjør2012m2016tilden periodenmeddethøyestevolumetoverførtevåpensiden1990.detteer fortsettelsenaventrendsomharpågåttsiden2004,medstadigøkendevolum. DestørsteeksportøreneavvåpeniperiodenvarUSA,Russland,Kina,Frankrike ogtyskland,somtilsammenstofor74%avalteksportertvolum,mensde størsteimportørenevarindia,saudimarabia,deforentearabiskeemirater,kina ogalgerie,somsamletimporterte34%avdettotalevolumetlevert.mens våpenleveransenetilmidtøstenogasiaogoseaniaharværtøkendefraforrige periode,medøkningpåhenholdsvis86og7,7%,harleveransenetileuropa, AfrikaogAmerikagåttned. Norgeerikkemedpådenneoversikten,daviikkevarblantdetistørste våpeneksportøreneiverdeniperioden2012m2016.vihavnetderimotpåplass nummer17,medenandelpå0,6%avdenglobalevåpeneksporten.dettevaren økningpå39%sammenlignetmedfemårsperiodenfør,ogvieksportertevåpen tilblantandreestland,litauen,malaysia,polenogoman. De-største-våpeneksportørene-og-deres-viktigste-markeder- Andelavtotalvåpeneksport HovedBimportører,(medimportørsandelav eksportørenstotaleeksport),2012b2016 Eksportør 2012M M11 Størst NestMstørst TredjeMstørst USA 33% 30% SaudiMArabia (13%) UAE (8,7%) Tyrkia (6,3%) Russland 23% 24% India (38%) Vietnam (11%) Kina (11%) Kina 6,2% 3,8% Pakistan (35%) Bangladesh (18%) Myanmar (10%) Frankrike 6% 6,9% Egypt (19%) Kina (11%) UAE (9,1%) Tyskland 5,6% 9,4% SørMKorea (13%) Hellas (12%) USA (9,7%) Storbritannia 4,6% 3,9% SaudiArabia (48%) India (11%) Indonesia (9%) Spania 2,8% 2,9% Australia (27%) SaudiMArabia (12%) Tyrkia (11%) Italia 2,7% 2,4% Tyrkia (14%) Algerie (11%) Angola (8%) Ukraina 2,6% 1,9% Kina (28%) Russland (17%) Thailand (8,5%) Israel 2,3% 2,2% India (41%) Aserbajdsjan (13%) USA (5,9%) 14

16 Defemstørsteeksportøreneavstorekonvensjonellevåpeniperioden2012M 2016varUSA,Russland,Kina,FrankrikeogTyskland,somstofor74%avdet samledeeksportvolumet. USA- USAbeholdersinposisjonsomdenstørsteeksportørenavstorekonvensjonelle våpeniverden,medomtrent33%avdettotaleeksportvolumet.amerikansk eksportøktemed21%fraperioden2007m2011til2012m2016,ogforspranget fortsattedermedåøkenedtilnummertopålisten,russland.usasolgteeller donertestorekonvensjonellevåpentilminst100stateriløpetavperioden,ogen storandelaveksportvolumet(47%)hargåtttillandimidtøsten.asiaog Oseaniafulgtetettetter,med35%. HovedmottagerforamerikanskevåpensystemervarSaudiMArabia,ogdethøye eksportvolumettilgulfmonarkietviltroligvedvare.usaskallevere154fm15sa jagerflytilsaudimarabia,ogleveransenebegyntei2016.usaharitilleggøktsin eksportavmissilforsvarssystemer,tillandsomqatar,kuwait,saudimarabia,og Deforentearabiskeemirater.Sistnevntelandvarførsteeksportdestinasjonfor THAADMsystemet,USAsmestavansertemissilforsvarssystem. Russland- Russlandøktesineksportavstorevåpensystemermed4,7%mellom2007M2011 og2012m2016.eksportenvari2016høyereenni2014og2015,menvikan likevelseennedgangsammenlignetmedårsom2011og2012.våpnenegikktil 50land,fortrinnsvisIndia,KinaogVietnam. RegionaltfortsattehovedvektenavvåpenleveranserågåtilAsiaogOseania(68 %),fulgtavafrika(12%)ogmidtøsten(8,1%).detbleiperiodenregistrert overføringeravvåpensystemerfrarusslandtilopprørereiukraina,ogtil Aserbajdsjan,somerinvolvertienkonfliktmedArmenia.Detbleimidlertidikke registrertoverføringertilaserbajdsjani2016. Kina- Kinesiskvåpeneksportøktemed74%fra2007M2011til2012M2016,ogKinaøkte sinandelavdentotaleglobaleeksporten.avtotalt44mottakerland, hovedsakeligiasia,gikkdetmesteaveksportentilpakistan,bangladeshog Myanmar. Deterspesieltkinesiskeksporttilafrikanskelandsomharøktsidenforrige femårsperiode(122%),mensdengeografiskespredningenavkinesiskevåpen ogsåharøkt.blantannetgårnåendelvåpentilsentralmasia. Tyskland-og-Frankrike- BådeFrankrikeogTysklandopprettholdtsinstatussomnoenavverdensstørste våpeneksportører,tiltrossforatdennedgangenieksportvolumobserverti tidligereperiodervedvartei2012m

17 FranskeleveranseravvåpengikkførstogfremsttilMidtøsten(38%),Asiaog Oseania(29%)ogEuropa(12,8%).Storeleveranseavtalerbleinngåttmed Malaysia(fregatter),Australia(ubåter),Egypt(fregatter),India,EgyptogQatar (jagerfly)iløpetavperioden.dettotaleeksportvolumetgikknedmed5% sammenlignetmedperioden2007m2011. Tyskeksportavvåpensankendakraftigere,med36%iforholdtil2007M landmottokvåpenfraTysklandi2012M2016,førstogfremstiEuropa,Asiaog OseaniaogMidtøsten. De-største-våpenimportørene-og-deres-viktigste-leverandører- Andelavtotalvåpenimport HovedBleverandører,(medandelav importørenstotaleimport),2012b2016 Importør 2012M M11 Størst NestMstørst TredjeMstørst India 13% 9,7% Russland (68%) USA (14%) Israel (7,2%) SaudiBArabia 8,2% 2,9% USA (52%) Storbritannia (27%) Spania (4,2%) UAE 4,6% 3,1% USA (62%) Frankrike (12%) Italia (6,5%) Kina 4,5% 5,5% Russland (57%) Ukraina (16%) Frankrike (15%) Algerie 3,7% 3,9% Russland (60%) Kina (15%) Tyskland (12%) Tyrkia 3,3% 2,5% USA (63%) Italia (12%) Spania (9,3%) Australia 3,3% 3,8% USA (60%) Spania (23%) Frankrike (8,2%) Irak 3,2% 1,6% USA (56%) Russland (23%) SørMKorea (9,3%) Pakistan 3,2% 4,8% Kina (68%) USA (16%) Italia (3,8%) Vietnam 3% 1,1% Russland (88%) Hviterussland (3,5%) Ukraina (2,8%) Av155landsomimportertevåpeni2011M2015stofemland India,SaudiM Arabia,Deforentearabiskeemirater,KinaogAlgerie for34%avdenne importen.india,kinaogdeforentearabiskeemiratervarogsåblantdefem størsteimportøreneiperioden2006m2010,mensindia,kinaogalgerievarblant defemstørsteimportørenei2007m2011. AsiaogOseaniaerdenverdensdelensommottardenstørsteandelenav verdensvåpenleveranser,med43%,enøkningiimportvolumpå7,7%siden 2007M2011.Halvpartenavverdenstistørsteimportøreravvåpenerasiatiske land.russlanderregionensstørsteleverandør,etterfulgtavusaogkina. 16

18 17 ØktspenningmellomlandmedterritorialkraviSørMkinahavetharbidratttil opprustningmedfokuspåmaritimesystemersomubåter,fregatter,antim skipsvåpen,støttefartøyerogkampfly.bådevietnam,filippinene,ogindonesia harøktsinvåpenimportbetraktelig. RegionenerogsåpregetavhistoriskekonfliktermellomIndiaogKinaogIndia ogpakistan,ogindiaharøktsinimportavvåpenmed43%fra2007m2011til 2012M2016.ImotsetningtilKina,somharredusertsinimportmed11%i sammeperiode,harikkeindiailikestorgradlykkesmedåutvikleegen produksjonavavansertevåpensystemer. Afrikanskelandsimportavvåpengikknedmed6,6%sammenlignetmed perioden2007m2011.algerie,marokkoognigeriaerdestørsteimportørene, mensrusslanderhovedleverandørtillandenepåkontinentet,etterfulgtavkina. Omtrent35%avimportengikktillandsørforSahara,fortrinnsvisNigeria, SudanogEtiopia,ogendelavdenneimportenkanknyttestilpågående konflikteridarfurogmotbokoharam,samthøytspenningsnivåmellometiopia ogeritrea.inordmafrikakanopprustningialgerieogmarokkoknyttestildet spenteforholdetmellomdetolandene,enutviklingsomantarformenavet rustningskappløp. LandiAmerikaredusertesinimportavvåpenmed18%sammenlignetmed perioden2007m2011.dennereduksjonenvarførstogfremstetresultataven betydelignedgangivåpenimportisørmamerika,hvorvenezuelaerrammetav økonomiskkriseogcolombiaharværtengasjertifredssamtalermedfarcm geriljaen.usastårfortsattfordenstørsteandelenavimporten,mensmexicohar fortsattåøkesinimportbetydeligsometresultatavkrigenmot narkotikakartellene. VolumetpåvåpenleveransermedEuropasomdestinasjongikknedmed36% fra2007m2011til2012m2016,blantannetpågrunnavvedvarendeøkonomiske problemerimangeland.denstørsteimportørenvarstorbritannia,som redusertesittimportvolummed22%sammenlignetmed2007m2011.usavar denstørsteleverandørentileuropeiskekunder,etterfulgtavtysklandog Russland. IVestMEuropaerdetførstogfremstjagerflyetFM35sompregerkostnadeneved våpenimport,ogsomvilfortsetteågjøredetiåreneframover.iøstmogsentralm EuropaerdetfryktenforRusslandsomharfåttmangelandtilåimportereflere tungevåpensystemer.forholdetmellomaserbajdsjanogarmeniaerfortsatt pregetavkonfliktenomnagornomkarabakh,ogbeggefortsattebeggeå importeretungevåpeniløpetavperioden.aserbajdsjansimportvarimidlertid 20gangerhøyereennArmenias,ogRusslandvarenviktigleverandørtilbegge land. Volumetpåleveranseravtungekonvensjonellevåpenmottattavlandi Midtøstenstegmedhele86%fra2007M2011til2012M2016.SaudiMArabia,De forentearabiskeemiraterogtyrkiavardestørsteimportørene,mensusa, StorbritanniaogFrankrikevardeviktigsteleverandørene.DeflesteGulfMlandene erinvolvertivæpnetkonflikt,entenijemen,syriaellerpåegetterritorium,og

19 landsomsaudimarabia,deforentearabiskeemirater,qatarogkuwaitharøktsin våpenimportbetydeligsidenforegåendefemårsperiode. OgsåTyrkiaogIrakøktesinimportavvåpen,tilbrukmotkurdiskegrupperog IS. Del3:Implikasjonerav#militært# forbruk Allelandharenretttilåforsvareseg,ogetmilitærtforsvarmedfører nødvendigvisetvisstforbrukforåvedlikeholdeogmoderniseredetteforsvaret. Dettekangjørespåøkonomiskforsvarligemåter,utenalvorligenegative implikasjonerforutvikling,sikkerhetogtrusselbilder.eksemplerpådetteer oppbyggingavdefensivtinnrettedeforsvarmotreelletruslerinnenfor forsvarligeøkonomiskerammer.deterimidlertidsituasjonerdaenstats militæreforbrukkansessommerproblematisk. Detteerogsåreflektertinorskogeuropeiskeksportkontrollregelverkfor militærtmateriell,sombådeharkriterierknyttettilbærekraftigutviklingog regionalspenning.detsåkalteutviklingskriterieteruttryktpådennemåten: [Detskalvære]Forenlighetmellomeksportenavmilitærteknologieller militærtutstyrogmottakerlandetsøkonomiskeogtekniskeevne,samtidigsom dettashensyntilatdeterønskeligatstaterkandekkesinelegitimesikkerhetsm ogforsvarsbehovmedminstmuliginnsatsavmenneskeligeogøkonomiske ressursertilvåpen» 9 OppsummertbetyrdetteatvåpeneksportfraNorgeogEUMlandeneikkeskal tillatesomdenneeksportenantasåvilleutgjøreethinderforutviklingi mottakerlandet. ItilleggkommeretkriteriumsomunderstrekeratNorgeskalavståfraeksport avmilitærtmateriellsomkanhaennegativinnvirkningpåregionalstabilitet. 10 Militært-forbruk-som-andel-av-BNP:- Den-militære-byrde - Allelandharmekanismerforåforsvaresegmotinterneogeksternetrusler,og deallerflestestaterinkludererformerformilitærtforsvarsomendelavdette. Forsvarsutgifteransesgjernesometnødvendigonde,eninvesteringsomikkeer 9 RetningslinjerforUtenriksdepartementetsbehandlingavsøknaderomeksportav forsvarsmateriell,samtteknologi%og%tjenester%for%militære%%formål %tilgjengelig%på:% retningslinjerMeksportMforsvarsmateriell.pdf 10 m dddpdfs.pdf,side75 18

20 positiv,idenforstandatdenofteikkemedførernevneverdigøkonomiskvekst, sysselsettingellerverdiskapning.deterenprissommåbetalesforåstyrke forsvarsevneogdemotivereeventuellefiendtligeaktørerfraåangripe.dette medførermindretilgjengeligeressursertilandreformål,somhelseog utdanning,ogdendelenavbnpsomgårtilådekkemilitærtforbrukrefereres gjernetilsometlands militærebyrde. Forsvaretsombyggesoppietlandbørsamsvaremeddentrusselsituasjonen landetståroverfor.inoentilfellerserviimidlertidatmilitærtforbrukblirtil militærtoverforbruk,dakostnadenesomgårtilvedlikeholdogopprustningikke ståristilmedtrusselbildet.enkonsekvensavdettekanværeatenstatbruker storeressurserpåmilitæroppbygging,framforpåinvesteringermedenmer sosialprofilihelsevesenellerutdanningssystemet.detkanhasværtnegative konsekvenserforetlandsutviklingdersommilitærvirksomhetprioriteres framforlangsiktigøkonomiskogsosialutvikling. Mensdeflestelandsmilitærebyrdegikknedetterdenkaldekrigen,såvii2015 enlitenoppsving,med20landsombrukteover4%avbnppåmilitærtforbruk. I2016gikkdetteigjenlitttilbake,til14land.Daerimidlertidnoenlandutelatt grunnetmanglendedata. Økonomiskforskningviseratmilitærtforbrukgenereltharennegativ innvirkningpåøkonomiskvekstilandidentredjeverden,itilleggtilennegativ effektpågjeldsnivåetimilitariserteland. 11 Fordeflesteutviklingslandvil militærtforbruk,spesieltimportavvåpenogannetmilitærtmateriell,medføre entungbyrdeforøkonomienoglandetshandelsbalanse.gjeldrelaterttil militærtforbrukeroftehøyiutviklingsland,ogavdragogrenterpågjeldfor tidligeremilitærimportpregerøkonomienilangtid. 12 MangelandiMidtøstenharenhøymilitærbyrde.SaudiMArabiasmilitære forbruktilsvarer10%avlandetsbnp,ognesten28%avsamledeoffentlige utgifter.omanharetmilitærtforbruktilsvarende16,7%avbnp,ognesten30 %avtotaleoffentligeutgifter. Noentilsvarendetendenserserviogsåilandmedbetydeligeutviklingspolitiske utfordringer.armeniabruker4%avbnppåmilitærtforbruk,mensdet tilsvarendetalletforiraker5,8%.republikkenkongobruker16,5%avtotale offentligeutgifterpåmilitæreformål.forchadertallet15,4%,forsudan24,7 %,ogforpakistan18,1%.dablirdetrelevantåspørreomdetteeretforbruk somgårpåbekostningavbærekraftigutvikling. 11 Smaldone,JosephP.,AfricanMilitarySpending:DefenceVersusDevelopment?AfricanSecurity Review15.4,side17M32.InstituteforSecurityStudies.Side22, Dunne,J.Paul;ogUye,Mehmet.DefenceSpendingandDevelopment,side6. 19

21 Forsvars7ogsikkerhetsbudsjettsom andelavbruttonasjonalprodukti ,4% 14,0% 11,6% 8,9% 6,4% 6,3% 6,1% 4,8% 4,6% 4,4% 4,4% 4,1% 4,0% 4,0% 3,9% Spenning-og-opprustning- EuropaerrepresentertvedRusslandogUkraina.Russlandhardesisteårene arbeidetforåstyrkesinmilitærekapabilitet,ogspenningsnivåetmellom stormaktenognatoharværtøkende.russlandharitilleggværtknyttettil opprørsgrupperiukraina,noesomharskaptbekymring,ogstyrkingav militærvesenet,bådeiukrainaogandrenaboland. Itilleggkanmilitæropprustningisegselvvirkespenningsdrivende.Dersomen situasjonpregetavethøytspenningsnivåmellomtolandforårsakermilitær opprustningietavlandene,kanresultatetbliøktspenningsnivåogytterligere opprustning,førsthosdenmilitærtunderlegne,såbesvartavdenandre involvertestaten.etsliktrustningskappløpkanførelandeneinnienondsirkel avstadigopprustning,utenatdenstrategiskebalansenmellomdemendres vesentlig,samtidigsomspenningsnivåetstiger.selvisituasjonerhvorøkt militærtforbrukiutgangspunktetvarbasertpårasjonelleanalyseromegen sikkerhet,vilenslikrustningsdynamikkideflestetilfellerhanegative konsekvenserfordeinvolvertelandeneettersomforbruketstiger. 20

22 21 ISørMkinahavetservitendensertildetsomkanværeetrustningskappløp mellomlandenemedterritorialkraviområdet,samtidigsomspenningsnivået harværtøkende.detsammekanværetilfelletiforholdetmellomrusslandog flereeuropeiskeland,sompregesavspenningogopprustning. Militærtforbrukiformavvåpenimportkanogsåværeproblematiskiforholdtil regionalsikkerhetogstabilitet.deterumuligåvitesikkerthvaetvåpensystem vilblibrukttiletteratdetersolgt.detharværtsværtmangetegntilatvåpen harblittsendtfraandreland,blantannetgulfstatene,somermottagereav vestligevåpen,tilisiirakogsyria. EtanneteksempelerangrepetpåJemenavdenSaudiMlededekoalisjonen,hvor storemengdervestligevåpenogammunisjonharblittbenyttet.detteerenkrig medenormemenneskeligeomkostninger,sommedførerstore flyktningestrømmerogsomkanvirkedestabiliserendepåheleregionen. Militarisering-av-samfunnet- BonnInternationalCenterforConversion(BICC)publisererhvertårenglobal militariseringsindeks.etsamfunnsgradavmilitariseringkanmålessom resultatetavenrekkeindikatorer,inkludertmilitæreutgiftersomandelavbnp, militæreutgiftersammenlignetmedutgiftertilhelsevesenet,forholdetmellom antallet(para)militærtpersonellogantallhelsepersonellsomandelav befolkningen,ogratioenmellomantallettungevåpensystemertilgjengeligog antalletinnbyggere. 13 Indekseneretmålforandelenressurser,førstogfremstøkonomiskeressurser, enstatbrukerpåmilitæreformålframforandre,gjernesosiale,formålsom helsevesen,utdanningssystemogmiljøarbeid.rapportenfor2016visertydelige tegnpåensterkeregradavmilitarisering,spesieltideleravøstmeuropa,ogdet erforventetatkonflikteniukrainaogethøyerespenningsnivåmellomnatoog Russlandogsåvilpåvirkemilitariseringenivesteuropeiskeland.Midtøsten preges,somtidligereår,avenhøymilitariseringsgradogflerekonflikter. Irapportensomdekker2016vardetIsrael,Singapore,Armenia,Jordan, Russland,SørMKorea,Kypros,Hellas,AserbajdsjanogBruneisomkomutsom BICCstimestmilitariserteland.Noenavverdensstørstemilitæreaktører kommeraltsåikkemedpålisten,blantannetsomresultatavrelativtlavere militæreutgiftersomandelavbnpenndenevntetilandenesombrukeren relativtstørreandelavsineressurserpåmilitæreformål. AvendringeriforholdtilåretførkandettrekkesframatbådeRusslandog Hellasharbevegetsegoppoverpålisten,ogBruneiharkommettilmensKuwait erute. IMidtøsten,somiverden,erdetIsraelsomtronerpåtoppenavlistenoverde mestmilitarisertestatene.ethøytantallmilitærtpersonellogutviklingogkjøp avtungevåpensystemererfaktorersombidrartildette.langvarigekonflikterog høyespenningsnivåererårsakentildennemilitariseringen,ogflereav 13

23 22 nabolandene,ogsåpåvirketavkonflikteneogspenningsnivået,harogsåhøye militariseringsgrader.dettegjelderlandsomegypt,saudimarabia,deforente arabiskeemirater,ogiran. IEuropaerdetførstogfremstArmeniaogAserbajdsjansomutmerkerseg, resultatetavdenpågåendekonfliktenomnagornomkarabakh.trefningeri2016 medførtebådesivileogmilitæredødsfall,ogspenningsnivåeterhøyt.itillegg harrusslandbevegetsegoppoverpålisten,medfortsattstoreutgiftertil moderniseringavdevæpnedestyrkeneoginnkjøpavtungevåpensystemer. ØkonomiskevanskeligheterharimidlertidbidratttilåbremsemoderniseringsM planene,ogplanlagtemilitæreutgiftererallerederedusertsometresultat.som etresultatavkonflikteniøstmukrainaharmilitariseringsgradeniukrainaøkt markant,medøkteforsvarsbudsjetterogstørrevæpnedestyrker,ogiflere baltiskeogøstmeuropeiskelandharmilitæreutgiftergåttoppmensbnphargått ned,medøktmilitariseringsomresultat.mangeavdisselandenesernåiøkende gradvestovernårdeskalkjøpemilitærtutstyr,forågjøresegmeruavhengigeav Russland. BICCbaserersegimangetilfellerpåtallmaterialefra2015,oghardermedikke registrertenmarkantendringigradavmilitariseringforvestmeuropeiskeland. Deterimidlertidforventetatvivilseenøkningiforsvarsbudsjetteroverde nesteåreneogsåher,sommangelandalleredeharannonsert. Norgehavnersomnummer36avverdensmestmilitariserteland,lavereenn Finland,menhøyereennSverigeogDanmark. IAsiagjørSingaporesegbemerket,medstorevæpnedestyrkersammenlignet medlandetsbeskjednebefolkning,ogavansertemodernevåpensystemer.sørm Koreascorerogsåhøytpåindeksen,myegrunnetkonfliktenmedNordMKorea,og harøktsinemilitæreutgifterdesenereårene.disseerplanlagtåøkesytterligere iframtiden,blantannetforutbyggingavetrakettskjoldrettetmotnordmkoreai samarbeidmedusa. SituasjoneniSørMkinahavetharennåikkefåttfølgerformilitariseringenav statenemedterritorialkraviområdet,menflereavdisse,inkludertkinaog Vietnam,harstartetmilitæremoderniseringsprogrammermedfokuspå marinen. Militarisering-og-menneskelig-utvikling- BlantstatenesombrukerdenhøyesteandelenavsittBNPpåmilitæreformål,er detflereomscorerdårligpåulikeutviklingsindekser.eteksempelerundps menneskeligeutviklingsindeks(hdi),sompublisereshvertår.utviklingsm indeksenfor2016viseratlandsomegypt,vietnam,ogkambodsja,somallehar enrelativthøygradavmilitarisering,harbetydeligeutviklingspolitiske utfordringer. 14 Deterderforrimeligåantaatdeomfattenderessursenedisse statenebrukerpåsinemilitærvesenmedhellkunnehablittoverførttilandre sektorermedstørrebetydningforøkonomiskogsosialutvikling. 14

24 Nårdetersagterdetingenautomatiskkorrelasjonmellomenhøygradav militariseringogenlavgradavmenneskeligutvikling.landsomsingapore, IsraelogSørMKoreaerbådehøytmilitariserte,ogkommergodtutpåoversikter overmenneskeligutvikling.deteraltsåikkenødvendigvistilfelletatredusert militærtforbrukbetyrmerøkonomiskogsosialutvikling.bicchar sammenlignetlandenesomscorerhøytpåmilitariseringsindeksenmedland somkommerdårligutpåinternationalfoodpolicyresearchinstitutesglobal HungerIndex,somogsåpublisereshvertår.Landmedhøynivåeravsultligger genereltpåetlavtmilitariseringsnivå,mendeterogsånoenavdisselandene, somchad,namibia,pakistanogangola,somogsåharenhøygradav militarisering.deterdermedvanskeligåfinneendirektekorrelasjonmellom dissetoindikatorene,selvomdeterlitentvilomatmilitærtforbrukreduserer denpotensiellepottensomkanbrukespåsosialeutgifter. - 23

25 Vedlegg-1:-Landinndeling-per-region-(SIPRIs-inndeling)- Afrika Nord-Afrika: Algerie, Libya, Marokko, Tunisia Afrika sør for Sahara: Angola, Benin, Botswana, Burkina Faso, Burundi, Kamerun, Kapp Verde, Den sentralafrikanske republikk, Tsjad, Kongo, DR Kongo, Elfenbenskysten, Djibouti, Ekvatorial-Guinea, Eritrea, Etiopia, Gabon, Gambia, Ghana, Guinea, Guinea-Bissau, Kenya, Lesotho, Liberia, Madagaskar, Malawi, Mali, Mauritania, Mauritius, Mosambik, Namibia, Niger, Nigeria, Rwanda, Senegal, Seychellene, Sierra Leone, Somalia, Sør-Afrika, Sør-Sudan, Sudan, Swaziland, Tanzania, Togo, Uganda, Zambia, Zimbabwe Amerika Sentral-Amerika og Karibia: Belize, Costa Rica, Cuba, Den dominikanske republikk, El Salvador, Guatemala, Haiti, Honduras, Jamaica, Mexico, Nicaragua, Panama, Trinidad og Tobago Nord-Amerika: Canada, USA Sør-Amerika: Argentina, Bolivia, Brasil, Chile, Colombia, Ecuador, Guyana, Paraguay, Peru, Uruguay, Venezuela Asia Sentral-Asia: Kasakhstan, Kirgisistan, Tadsjikistan, Turkmenistan, Usbekistan Øst-Asia: Brunei, Kambodsja, Kina, Indonesia, Japan, Nord-Korea, Sør-Korea, Laos, Malaysia, Mongolia, Myanmar, Filippinene, Singapore, Taiwan, Thailand, Øst-Timor, Vietnam Sør-Asia: Afghanistan, Bangladesh, India, Nepal, Pakistan, Sri Lanka Oseania: Australia, Fiji, New Zealand, Papua Ny-Guinea Europa Albania, Armenia, Østerrike, Aserbajdsjan, Hviterussland, Belgia, Bosnia- Herzegovina, Bulgaria, Kroatia, Kypros, Tsjekkia, Danmark, Estland, Finland, Frankrike, Georgia, Tyskland, Hellas, Ungarn, Island, Irland, Italia, Latvia, Litauen, Luxembourg, Makedonia, Malta, Moldova, Montenegro, Nederland, Norge, Polen, Portugal, Romania, Russland, Serbia, Slovakia, Slovenia, Spania, Sverige, Sveits, Storbritannia, Ukraina Midtøsten Bahrain, Egypt, Iran, Irak, Israel, Jordan, Kuwait, Libanon, Oman, Qatar, Saudi- Arabia, Syria, Tyrkia, Forente arabiske emirater, Jemen 24





Statistikk 2007: Uttransporteringer fra Norge

Statistikk 2007: Uttransporteringer fra Norge Statistikk 2007: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 2628 personer i 2007. 2187 av disse var tvangsreturer og 441 var frivillige returer. PU har det nasjonale ansvaret


Innvandrerbefolkningen i Tromsø 2011

Innvandrerbefolkningen i Tromsø 2011 Plan og næring, gej, 13.09.11 Innvandrerbefolkningen i Tromsø 2011 I 2011 utgjør innvandrerbefolkningen i Tromsø 6086 personer eller 8,9 prosent av folkemengden. Til sammenligning var andelen 6,6 prosent


Politiets utlendingsenhet (PU) uttransporterte 417 personer i november Av disse var 146 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 417 personer i november Av disse var 146 ilagt en eller flere straffereaksjoner. Månedsstatistikk november 2017: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 417 personer i november 2017. Av disse var 146 ilagt en eller flere straffereaksjoner. PU har


Politiets utlendingsenhet (PU) uttransporterte 416 personer i oktober Av disse var 163 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 416 personer i oktober Av disse var 163 ilagt en eller flere straffereaksjoner. Månedsstatistikk oktober 2017: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 416 personer i oktober 2017. Av disse var 163 ilagt en eller flere straffereaksjoner. PU har det


Politiets utlendingsenhet (PU) uttransporterte 430 personer i september Av disse var 172 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 430 personer i september Av disse var 172 ilagt en eller flere straffereaksjoner. Månedsstatistikk september 2017: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 430 personer i september 2017. Av disse var 172 ilagt en eller flere straffereaksjoner. PU har


Politiets utlendingsenhet (PU) uttransporterte 404 personer i august Av disse var 178 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 404 personer i august Av disse var 178 ilagt en eller flere straffereaksjoner. Månedsstatistikk august 2017: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 404 personer i august 2017. Av disse var 178 ilagt en eller flere straffereaksjoner. PU har det


Politiets utlendingsenhet (PU) uttransporterte 447 personer i juli Av disse var 163 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 447 personer i juli Av disse var 163 ilagt en eller flere straffereaksjoner. Månedsstatistikk juli 2017: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 447 personer i juli 2017. Av disse var 163 ilagt en eller flere straffereaksjoner. PU har det nasjonale


Politiets utlendingsenhet (PU) uttransporterte 712 personer i desember Av disse var 215 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 712 personer i desember Av disse var 215 ilagt en eller flere straffereaksjoner. Månedsstatistikk desember 2016: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 712 personer i desember 2016. Av disse var 215 ilagt en eller flere straffereaksjoner. Totalt


Politiets utlendingsenhet (PU) uttransporterte 461 personer i juni Av disse var 198 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 461 personer i juni Av disse var 198 ilagt en eller flere straffereaksjoner. Månedsstatistikk juni 2017: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 461 personer i juni 2017. Av disse var 198 ilagt en eller flere straffereaksjoner. PU har det nasjonale


Uttransport av straffede de siste fire årene

Uttransport av straffede de siste fire årene Månedsstatistikk desember : Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 869 personer i desember. Av disse var 173 ilagt en eller flere straffereaksjoner. PU gjennomførte


Politiets utlendingsenhet (PU) uttransporterte 452 personer i mai Av disse var 179 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 452 personer i mai Av disse var 179 ilagt en eller flere straffereaksjoner. Månedsstatistikk mai 2017: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 452 personer i mai 2017. Av disse var 179 ilagt en eller flere straffereaksjoner. PU har det nasjonale


Politiets utlendingsenhet (PU) uttransporterte 464 personer i april Av disse var 165 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 464 personer i april Av disse var 165 ilagt en eller flere straffereaksjoner. Månedsstatistikk april 2017: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 464 personer i april 2017. Av disse var 165 ilagt en eller flere straffereaksjoner. PU har det nasjonale


Månedsstatistikk august 2011: Uttransporteringer fra Norge

Månedsstatistikk august 2011: Uttransporteringer fra Norge Månedsstatistikk august 2011: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 311 personer i august. Til sammen har PU tvangsmessig uttransportert 2968 personer så langt i år,


Uttransport av straffede de siste fire årene

Uttransport av straffede de siste fire årene Månedsstatistikk september 2015: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 734 personer i september 2015. Av disse var 220 ilagt en eller flere straffereaksjoner. Det


Uttransport av straffede de siste fire årene

Uttransport av straffede de siste fire årene Månedsstatistikk oktober 2015: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 655 personer i oktober 2015. Av disse var 204 ilagt en eller flere straffereaksjoner. Det tilsvarer


Politiets utlendingsenhet (PU) uttransporterte 532 personer i desember 2014. Av disse var 201 ilagt en straffereaksjon.

Politiets utlendingsenhet (PU) uttransporterte 532 personer i desember 2014. Av disse var 201 ilagt en straffereaksjon. Månedsstatistikk desember 2014: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 532 personer i desember 2014. Av disse var 201 ilagt en straffereaksjon. Totalt i 2014 ble 7259


Månedsstatistikk juli 2011: Uttransporteringer fra Norge

Månedsstatistikk juli 2011: Uttransporteringer fra Norge Månedsstatistikk juli 211: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 325 personer i juli. Til sammen har PU tvangsmessig uttransportert 2657 personer så langt i år. Økningen


Politiets utlendingsenhet (PU) uttransporterte 541 personer i mars Av disse var 197 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 541 personer i mars Av disse var 197 ilagt en eller flere straffereaksjoner. Månedsstatistikk mars 2017: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 541 personer i mars 2017. Av disse var 197 ilagt en eller flere straffereaksjoner. PU har det nasjonale


Norsk eksport av fisk totalt per marked 1 Mengde i tonn, verdi i 1000 NOK

Norsk eksport av fisk totalt per marked 1 Mengde i tonn, verdi i 1000 NOK Norsk eksport av fisk totalt per marked 1 Ureviderte tall TOTALT 191.995 4.445.055 23,15 2.528.594 52.064.814 20,59 2.439.256 53.384.049 21,89 EU27 104.680 2.547.226 24,33 1.387.500 29.985.849 21,61 1.260.682


Innvandrete personer, etter statsborgerskap og kommuner i Møre og Romsdal. 2008. Celler som inneholder 1 eller 2 forekomster er "prikket"

Innvandrete personer, etter statsborgerskap og kommuner i Møre og Romsdal. 2008. Celler som inneholder 1 eller 2 forekomster er prikket 1502 Molde Norge 21 Polen 90 Tyskland 29 Sverige 16 Litauen 12 Kina 11 Somalia 9 Storbritannia 6 Danmark 5 Estland 4 Filippinene 4 Irak 4 Finland 3 Hviterussland 3 Thailand 3 Brasil 3 Nepal 3 Canada. Colombia.


Politiets utlendingsenhet (PU) uttransporterte 824 personer i november 2014. Av disse 824 var 200 ilagt en straffereaksjon.

Politiets utlendingsenhet (PU) uttransporterte 824 personer i november 2014. Av disse 824 var 200 ilagt en straffereaksjon. Månedsstatistikk november 2014: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 824 personer i november 2014. Av disse 824 var 200 ilagt en straffereaksjon. Hittil i år har


Yrkesaktive leger under 70 år i Norge per 3. juli 2017, data fra Legeforeningens legeregister (CRM).

Yrkesaktive leger under 70 år i Norge per 3. juli 2017, data fra Legeforeningens legeregister (CRM). Yrkesaktive leger under 70 år i Norge per 3. juli 2017, data fra Legeforeningens legeregister (CRM). v76 DNLFNAA: Dnlf-medlem, 0 = aldri medlem Dnlf, 1 = medlem Dnlf, 2 = tidligere medlem 0 0 252 0.9 1


Straffede. Månedsstatistikk desember 2013: Uttransporteringer fra Norge

Straffede. Månedsstatistikk desember 2013: Uttransporteringer fra Norge Månedsstatistikk desember 2013: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 483 personer i desember 2013. Blant de som ble uttransportert i desember 2013 var 164 ilagt straffereaksjon.


Hittil i år har det blitt uttransportert 1986 personer ilagt straffereaksjon, mot 1838 i samme periode i fjor.

Hittil i år har det blitt uttransportert 1986 personer ilagt straffereaksjon, mot 1838 i samme periode i fjor. Månedsstatistikk oktober 2014: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 824 personer i oktober 2014. Dette er det høyeste antallet på en måned i PUs historie, og av disse


Uttransport av straffede de siste fire årene

Uttransport av straffede de siste fire årene Månedsstatistikk august 2015: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 555 personer i august 2015. Av disse var 189 ilagt en eller flere straffereaksjoner. Det tilsvarer


I løpet av 2012 har PU tvangsmessig uttransportert personer.

I løpet av 2012 har PU tvangsmessig uttransportert personer. Månedsstatistikk desember 212: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 436 personer i desember 212, mot 39 personer i desember 211. Blant de som ble uttransportert i


Politiets utlendingsenhet (PU) uttransporterte 497 personer i juli 2014. Av disse var 181 ilagt en straffereaksjon.

Politiets utlendingsenhet (PU) uttransporterte 497 personer i juli 2014. Av disse var 181 ilagt en straffereaksjon. Månedsstatistikk juli 2014: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 497 personer i juli 2014. Av disse var 181 ilagt en straffereaksjon. Hittil i år har det blitt uttransportert


Priser til fasttelefoner i utlandet Prisgruppene

Priser til fasttelefoner i utlandet Prisgruppene Priser til fasttelefoner i utlandet Prisgruppene Prislisten for gruppe 1-5 gjelder for alle vanlige hjemmetelefoner/geografiske nummer. Vi gjør oppmerksom på at inndelingen av hva som er fastnettnummer


Politiets utlendingsenhet (PU) uttransporterte 430 personer i februar Av disse var 155 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 430 personer i februar Av disse var 155 ilagt en eller flere straffereaksjoner. Månedsstatistikk februar 2017: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 430 personer i februar 2017. Av disse var 155 ilagt en eller flere straffereaksjoner. PU har det


Straffede. Månedsstatistikk februar 2014: Uttransporteringer fra Norge

Straffede. Månedsstatistikk februar 2014: Uttransporteringer fra Norge Månedsstatistikk februar 2014: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 560 personer i februar 2014. Blant de som ble uttransportert i februar 2014 var 209 ilagt straffereaksjon.



BONUS: KVAR DU HAR VORE, OG KVA DU HAR GJORT 484 BONUS: KVAR DU HAR VORE, OG KVA DU HAR GJORT BONUS: KVAR DU HAR VORE, OG KVA DU HAR GJORT Her kan du sjølv fylle ut kvar du har vore, og kva du har gjort der. Eg anbefaler at du summerer med blyant,


Politiets utlendingsenhet (PU) uttransporterte 534 personer i mars 2014. Blant de som ble uttransportert i mars 2014 var 198 ilagt straffereaksjon.

Politiets utlendingsenhet (PU) uttransporterte 534 personer i mars 2014. Blant de som ble uttransportert i mars 2014 var 198 ilagt straffereaksjon. Månedsstatistikk mars 2014: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 534 personer i mars 2014. Blant de som ble uttransportert i mars 2014 var 198 ilagt straffereaksjon.


Politiets utlendingsenhet (PU) uttransporterte 583 personer i mars 2015. Av disse 583 var 227 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 583 personer i mars 2015. Av disse 583 var 227 ilagt en eller flere straffereaksjoner. Månedsstatistikk mars 2015: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 583 personer i mars 2015. Av disse 583 var 227 ilagt en eller flere straffereaksjoner. PU har det


Endringene er gjort gjeldende med virkning fra 1. januar 2007. Etter fullmakt. Jørn Skille statens personaldirektør

Endringene er gjort gjeldende med virkning fra 1. januar 2007. Etter fullmakt. Jørn Skille statens personaldirektør Det kongelige Fornyings- og administrasjonsdepartement PM 2006-19 Særavtale for reiser utenlands for statens regning - endring av satser for kostgodtgjørelse og nattillegg Dato: 07.12.2006 Til: Statsforvaltningen


Tromsøstatistikk. Befolkning

Tromsøstatistikk. Befolkning Tromsøstatistikk Befolkning INNHOLD 1 Folkemengden i hele landet, Troms fylke og Tromsø kommune2 2 Folkemengdens bevegelse3 3 Folkemengden i Tromsø kommune etter kjønn og alder Befolkningspyramide per





Tromsøstatistikk. Befolkning

Tromsøstatistikk. Befolkning Tromsøstatistikk Befolkning INNHOLD 1. Folkemengden i hele landet, Troms fylke og Tromsø kommune...2 2. Folkemengdens bevegelse.... Folkemengden i Tromsø kommune etter kjønn og alder...5. Befolkningspyramide


Politiets utlendingsenhet (PU) uttransporterte 429 personer i januar Av disse var 159 ilagt en eller flere straffereaksjoner.

Politiets utlendingsenhet (PU) uttransporterte 429 personer i januar Av disse var 159 ilagt en eller flere straffereaksjoner. Månedsstatistikk januar 2017: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 429 personer i januar 2017. Av disse var 159 ilagt en eller flere straffereaksjoner. PU har det


Tvangsmessig uttransporterte straffedømte de siste 4 årene

Tvangsmessig uttransporterte straffedømte de siste 4 årene Månedsstatistikk mars 213: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 415 personer i mars 213, mot 428 personer i mars 212. Blant de som ble uttransportert i mars 213 var


Telio World & Telio World All Inclusive Priser til fastlinje og mobil i utlandet

Telio World & Telio World All Inclusive Priser til fastlinje og mobil i utlandet Telio World & Telio World All Inclusive Priser til fastlinje og mobil i utlandet Samtaler til utlandet faktureres per minutt. Alle priser er inklusiv moms. Antall minutter gratis per m ned Pris per minutt


Nye FedEx-satser Gjelder fra 4. januar 2016

Nye FedEx-satser Gjelder fra 4. januar 2016 Nye FedEx-satser Gjelder fra. januar 0 Enten dine forsendelser er tunge eller lette, og enten de haster eller er mindre tidssensitive, har FedEx en forsendelsesløsning for deg. Dra nytte av konkurransedyktige


Spørsmålsstiller viser til at det i kravspesifikasjonen, under punkt 2. står skrevet:

Spørsmålsstiller viser til at det i kravspesifikasjonen, under punkt 2. står skrevet: Spørsmål fra aktuelle tilbydere i forbindelse med Riksrevisjonens anskaffelse av abonnements-/trafikktjenester for mobil- og fasttelefoni, samt leveranse av mobiltelefoner og utstyr. Konkurransen er publisert


Tromsøstatistikk. Befolkning

Tromsøstatistikk. Befolkning Tromsøstatistikk Befolkning INNHOLD 1. Folkemengden i hele landet, Troms fylke og Tromsø kommune... 2 2. Folkemengdens bevegelse... 3 3. Folkemengden i Tromsø kommune etter kjønn og alder... 5 4. Befolkningspyramide


I løpet av 2013 har PU tvangsmessig uttransportert 798 personer.

I løpet av 2013 har PU tvangsmessig uttransportert 798 personer. Månedsstatistikk februar 213: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 4 personer i februar 213, mot 429 personer i februar 212. Blant de som ble uttransportert i januar


Her følger en oversikt over våre oppdaterte priser på internasjonale samtaler ved bruk av Infonett Telefoni.

Her følger en oversikt over våre oppdaterte priser på internasjonale samtaler ved bruk av Infonett Telefoni. Prisliste utenlandssamtaler fra Her følger en oversikt over våre oppdaterte priser på internasjonale samtaler ved bruk av Infonett Telefoni. Internasjonale samtaler Starttakst Landskode Minuttpris Afghanistan


Nye FedEx-satser Gjelder fra 4. januar 2016

Nye FedEx-satser Gjelder fra 4. januar 2016 Nye FedEx-satser Gjelder fra. januar 0 Enten dine forsendelser er tunge eller lette, og enten de haster eller er mindre tidssensitive, har FedEx en forsendelsesløsning for deg. Dra nytte av konkurransedyktige


Samtaler i Norge. Prisliste Enivest AS Gjeldende fra 1.april 2012. IP-Telefoni med gratis Norgestakst

Samtaler i Norge. Prisliste Enivest AS Gjeldende fra 1.april 2012. IP-Telefoni med gratis Norgestakst Samtaler i Norge IP-Telefoni med gratis Norgestakst Pris Inklusive mva Til fasttelefon og mobiltelefon Tidssone Startpris Minuttpris Norgestakst Hverdag 08-17 0,000 0,000 Norgestakst Hverdag 17-08 og helg


Nå har vi satt ned prisene igjen!

Nå har vi satt ned prisene igjen! Telefonen kostar 499kr inkl moms Månadskostnad 159kr (Du ringer obegränsat till fasta nätet till över 100 länder) Nå har vi satt ned prisene igjen! Vi gjør det nå enda billigere for deg å ringe til store


Utvandring, etter statsborgerskap og kommuner i Møre og Romsdal. 2008.

Utvandring, etter statsborgerskap og kommuner i Møre og Romsdal. 2008. 1502 Molde Norge 30 Danmark. Finland. Island 3 Sverige 10 Tyskland 9 Italia. Nederland. Polen 7 Litauen. Russland. Ungarn 3 Østerrike. Egypt. Ghana. Tanzania. Filippinene. India. Irak. Kina 3 Nepal 4 Pakistan


Prisliste. Priser for: Trafikk i utlandet (roaming) Ringe til utlandet Priser til spesialnummer

Prisliste. Priser for: Trafikk i utlandet (roaming) Ringe til utlandet Priser til spesialnummer Prisliste Priser for: Trafikk i utlandet (roaming) Ringe til utlandet Priser til spesialnummer Primafon AS Prisliste mobil gjeldende fra 01. juli 2016 Alle priser er inkl mva. Primafon AS. Vi tar forbehold


KOMMISJONSFORORDNING (EF) nr. 1492/96. av 26. juli 1996

KOMMISJONSFORORDNING (EF) nr. 1492/96. av 26. juli 1996 Nr. 42/40 EØS-tillegget til De Europeiske Fellesskaps Tidende 8.10.1998 NORSK utgave KOMMISJONEN FOR DE EUROPEISKE FELLESSKAP HARunder henvisning til traktaten om opprettelse av Det europeiske fellesskap,


Arbeidsløyve etter år og kategori 1998-2003. Utdanning 2003

Arbeidsløyve etter år og kategori 1998-2003. Utdanning 2003 5. Nøkkeltall 22 Arbeidsløyve 2003 Grunnlag for BOS* Fornybare løyve Ikkje fornybare løyve Landbakgrunn Spesialist Andre Fornybar Fornybar Sesong Andre EØS Andre/ Totalt Fornyingar Bos inntil 4 år inntil


UTENLANDS- OG BARNETILLEGG justert PR 1. JANUAR 2017 ft ny UD avtale Fenrik/Sersjant kl.1. Oberst / Oberstløytnant. Sersjantmajor (tilsv)

UTENLANDS- OG BARNETILLEGG justert PR 1. JANUAR 2017 ft ny UD avtale Fenrik/Sersjant kl.1. Oberst / Oberstløytnant. Sersjantmajor (tilsv) Vedlegg 4 Satser Satsene er basert på utenriksdepartementets satser slik de fremkommer av UDs Særavtale om tillegg, ytelser og godtgjørelser i utenrikstjenesten, og vil normalt bli justert 2 ganger pr


Nye FedEx-priser. Hvordan beregne prisen for forsendelsen. For mer informasjon kan du ringe kundeservice på telefon

Nye FedEx-priser. Hvordan beregne prisen for forsendelsen. For mer informasjon kan du ringe kundeservice på telefon Nye FedEx-priser Gjelder i Norge fra. januar 0 Enten dine forsendelser er tunge eller lette, og enten de haster eller er mindre tidssensitive, har FedEx en forsendelsesløsning for deg. Dra nytte av konkurransedyktige


Så langt i 2013 har PU tvangsmessig uttransportert 4 237 personer.

Så langt i 2013 har PU tvangsmessig uttransportert 4 237 personer. Månedsstatistikk september 2013: Uttransporteringer fra Norge Politiets utlendingsenhet (PU) uttransporterte 591 personer i september 2013, mot 417 personer i september 2012. Blant de som ble uttransportert



FLYKTNINGREGNSKAPET 2013 FLYKTNING 2013 REGNSKAPET ALT om mennesker På FLuKT verden over Hovedtall og trender Hovedfunn GLOBALT 45,2 millioner mennesker er på flukt verden over. Dette er det høyeste tallet som er registrert etter


Tuberkulose hva er nytt? - og litt om meslinger

Tuberkulose hva er nytt? - og litt om meslinger Tuberkulose hva er nytt? - og litt om meslinger Buskerud 15/4 2015 Trude M. Arnesen Overlege dr med Avdeling for infeksjonsovervåking Folkehelseinstituttet Skal snakke om Hva er tuberkulose (TB) Forekomst


Endrede skatteregler for tjenestereiser.

Endrede skatteregler for tjenestereiser. Det kongelige Fornyings- og administrasjonsdepartement PM 2007-16 Særavtale for reiser utenlands for statens regning. Særavtale for reiser innenlands for statens regning. Endring av satser for kostgodtgjørelse


Nr. 12 2013. Staff Memo. Pengepolitikk. Flere fremvoksende økonomier inkluderes i Norges Banks handelspartneraggregat. Bjørnar K.

Nr. 12 2013. Staff Memo. Pengepolitikk. Flere fremvoksende økonomier inkluderes i Norges Banks handelspartneraggregat. Bjørnar K. Nr. 12 213 Staff Memo Pengepolitikk Flere fremvoksende økonomier inkluderes i Norges Banks handelspartneraggregat Bjørnar K. Slettvåg Staff Memos present reports and documentation written by staff members


KOMMISJONSFORORDNING (EF) nr. 2247/98. av 13. oktober 1998

KOMMISJONSFORORDNING (EF) nr. 2247/98. av 13. oktober 1998 Nr.50/34 EØS-tillegget til De Europeiske Fellesskaps Tidende 9.11.20 KOMMISJONSFORORDNING (EF) nr. 2247/98 av 13. oktober 1998 om endring av vedlegg II til rådsforordning (EØF) nr. 2455/92 om eksport og


Militærtforbrukog globalvåpenflyt2014. AvAlexanderHarang UtgitavNorgesFredslag,29.april2014 RapportenerfinansiertmedstøtefraNorad

Militærtforbrukog globalvåpenflyt2014. AvAlexanderHarang UtgitavNorgesFredslag,29.april2014 RapportenerfinansiertmedstøtefraNorad Militærtforbrukog globalvåpenflyt2014 AvAlexanderHarang UtgitavNorgesFredslag,29.april2014 RapportenerfinansiertmedstøtefraNorad Innledning I 2013 brukte verden 1 747 milliarder dollar på militært forbruk.


Norges Skatteavtaler

Norges Skatteavtaler Unni Bjelland Norges Skatteavtaler ajour 10. august 1993 \ Ernst '& Young / 1993 Innhold Side Forord 5 Veiledning om bokens oppbygging 7 Kapittel 1 Internasjonal dobbeltbeskatning av inntekt 13 1.1 Skatteplikt


+ Verdensomspennende motstand mot antipersonelllandminer

+ Verdensomspennende motstand mot antipersonelllandminer Hovedpunkter Landminekonvensjonen og landminekampanjen generelt gjør store framskritt i kampen mot et totalforbud mot antipersonell-landminer (APM) og i forhold til å redde liv og lemmer i hver eneste


Flyktningregnskapet 2016. Totalt antall mennesker som. har flyktet til landet 3) flyktninger som har flyktet til landet 4) Andel kvinner blant

Flyktningregnskapet 2016. Totalt antall mennesker som. har flyktet til landet 3) flyktninger som har flyktet til landet 4) Andel kvinner blant STATISTIKK AFRIKA PÅ FLUKT VERDEN OVER fra 2015 3) Abyei 7) 82 000 Algerie 8) 39,7 1 773 100 775 37% 32% 2 447 11 113 Angola 25,0 12 45 698 3 882 15 139 Benin 10,9 225 708 48% 32% 536 1 576 Botswana 2,3-582


EØS-tillegget til De Europeiske Fellesskaps Tidende KOMMISJONSVEDTAK. av 8. februar 2000

EØS-tillegget til De Europeiske Fellesskaps Tidende KOMMISJONSVEDTAK. av 8. februar 2000 Nr. 3/169 KOMMISJONSVEDTAK 2002/EØS/03/57 av 8. februar 2000 om midlertidig godkjenning av tredjestaters planer for restmengder i samsvar med rådsdirektiv 96/23/EF(*) [meddelt under nummer K(2000) 343]


Innvandrerbefolkningen 1. januar 1997

Innvandrerbefolkningen 1. januar 1997 17. juni 1998 Aktuelle befolkningstall Innvandrerbefolkningen 1. januar 1997 Statistisk sentralbyrå ber om å bli oppgitt som kilde når oppgaver fra dette heftet blir gjengitt. 3 98 Aktuelle befolkningstall



PRIVAT EIENDOMSRETT OG DE FATTIGSTE PRIVAT EIENDOMSRETT OG DE FATTIGSTE Hvert år gir Property Rights Alliance og Institute for Liberty and Democracy, sistnevnte ledet av den peruvianske økonomen Hernando de Soto, ut rapporten International


Resultater fra PISA 2009. Marit Kjærnsli ILS, Universitetet i Oslo

Resultater fra PISA 2009. Marit Kjærnsli ILS, Universitetet i Oslo Resultater fra PISA 2009 Marit Kjærnsli ILS, Universitetet i Oslo Deltakelse PISA 2009 Internasjonalt: - 65 land - 34 OECD-land Nasjonalt: - 197 skoler - Omtrent 4700 elever PISA (Programme for International


Hovedpunkter 1999-2004

Hovedpunkter 1999-2004 Hovedpunkter 1999-2004 Det er til overmål klart fra den store mengden informasjon som ligger i Landmine Monitor Report 2004, at Landminekonvensjonen og landminekampanjen generelt gjør enorme framskritt


Global mobilitet i Erasmus+ Camilla Krebs Førstekonsulent, SIU Erasmusseminaret Ålesund/02.12.14

Global mobilitet i Erasmus+ Camilla Krebs Førstekonsulent, SIU Erasmusseminaret Ålesund/02.12.14 Global mobilitet i Erasmus+ Camilla Krebs Førstekonsulent, SIU Erasmusseminaret Ålesund/02.12.14 Global mobilitet o Del av den internasjonale dimensjonen i Erasmus+ o Mobilitetssamarbeid med partnerland


Internasjonale FoU-trender

Internasjonale FoU-trender Redaktør/seniorrådgiver Kaja Wendt 15-10-2014 Internasjonale FoU-trender Indikatorrapporten 2014 Lanseringsseminar, Norges forskningsråd, Lysaker, 15. oktober 2014 Internasjonale trender i FoU 1. Fordeling


Global mobilitet. Benedicte Einarsen SIU Bergen/12.01.16

Global mobilitet. Benedicte Einarsen SIU Bergen/12.01.16 Global mobilitet Benedicte Einarsen SIU Bergen/12.01.16 Litt om Erasmus+ Global mobilitet Erasmus+ åpnet i 2015 opp for muligheten til å utføre student- og ansatt mobiliteter til deler av verden utenfor



ÅRSRAPPORT ARBEIDET PÅ SELVHJELP ÅRSRAPPORT ARBEIDET PÅ SELVHJELP 2007 Oslo - Kristiansand - Ålesund - Trondheim - Bergen INNHOLD : I Selvhjelp Oslo - Kristiansand - Ålesund - Trondheim - Bergen Selvhjelp - en språkmektig gruppe Nasjonaliteter


Phonect priser. Innholdsfortegnelse. Mobil. Tilleggstjenester. Gebyr. Nasjonal Trafikk. Samtaler til Utland & fra Norge. Samtaler i utlandet

Phonect priser. Innholdsfortegnelse. Mobil. Tilleggstjenester. Gebyr. Nasjonal Trafikk. Samtaler til Utland & fra Norge. Samtaler i utlandet Innholdsfortegnelse Mobil Tilleggstjenester Gebyr Nasjonal Trafikk Samtaler til Utland & fra Norge Samtaler i utlandet SMS/MMS Utland Priser data utland Samtaler til Spesialnummer IPT SamKom Mobil Abonnement


PRISLISTE 01.01.2004

PRISLISTE 01.01.2004 www.flagg.no PRISLISTE 01.01.2004 info@flagg.no NORSKE FLAGG 50 x 36 175 217 65 x 47 195 241 75 x 55 207 256 85 x 62 215 267 100 x 73 224 278 125 x 91 257 319 150 x 109 361 448 175 x 127 465 577 200 x


Utkast til forskrift om endring i TSE-forskriften

Utkast til forskrift om endring i TSE-forskriften Utkast til forskrift om endring i TSE-forskriften Hjemmel: Fastsatt av Mattilsynet [dato] med hjemmel i lov 19. desember 2003 nr. 124 om matproduksjon og mattrygghet mv. (matloven) 7, 12, 15, 16, 19 og



ÅRSRAPPORT ARBEIDET PÅ SELVHJELP ÅRSRAPPORT ARBEIDET PÅ SELVHJELP 2001 Oslo - Kristiansand - Ålesund - Trondheim - Tromsø INNHOLD : I Selvhjelp Oslo - Kristiansand - Ålesund - Trondheim Selvhjelp - en språkmektig gruppe Nasjonaliteter


1. Verda. Kommentarar: tekstdel s. 23

1. Verda. Kommentarar: tekstdel s. 23 1. Verda Kommentarar: tekstdel s. 23 1.1 Dei største språka i verda 2009* F 1.1 Språk i verda 2008 F 1.2 Utbreiing av mandarin i Kina F 1.3 Utbreiing av mandarin og andre kinesiske språk i verda 2009 F


1. I Norge er det fem landsdeler. Plasser navnene på kartet.

1. I Norge er det fem landsdeler. Plasser navnene på kartet. 10 LANDSDELER I NORGE 1. I Norge er det fem landsdeler. Plasser navnene på kartet. 1. Østlandet 2. Vestlandet 3. Sørlandet 4. Midt-Norge 5. Nord-Norge 2. Skriv de retningene som mangler: 11 NORGE I EUROPA


Tid for tunge løft. Norske elevers kompetanse i naturfag, lesing og matematikk i PISA 2006. Marit Kjærnsli ILS, Universitetet i Oslo

Tid for tunge løft. Norske elevers kompetanse i naturfag, lesing og matematikk i PISA 2006. Marit Kjærnsli ILS, Universitetet i Oslo Tid for tunge løft Norske elevers kompetanse i naturfag, lesing og matematikk i PISA 2006 Marit Kjærnsli ILS, Universitetet i Oslo PISA 15-åringers kompetanse i lesing, matematikk og naturfag Undersøkelse


Internasjonale trender for FoU og innovasjon Lanseringsseminar, Norges forskningsråd, Lysaker, 19. oktober 2016

Internasjonale trender for FoU og innovasjon Lanseringsseminar, Norges forskningsråd, Lysaker, 19. oktober 2016 Kaja Wendt Internasjonale trender for FoU og innovasjon Lanseringsseminar, Norges forskningsråd, Lysaker, 19. oktober 2016 Norge er fortsatt et lite land i verden Norge vs. verden Norge som del av verden


MIGRASJON. Fakta og diskusjon om

MIGRASJON. Fakta og diskusjon om Fakta og diskusjon om MIGRASJON Migrasjon er at mennesker forflytter seg mellom land og regioner, av forskjellige årsaker. Samtidig som det strammes inn på s rett til å få opphold, er det fri bevegelse


Landkode bokstaver. Side 1 av 6

Landkode bokstaver. Side 1 av 6 ID Land 1 2 AFGHANISTAN AF 404 3 ALBANIA AL 111 4 ALGERIE DZ 203 5 AM. SAMOA AS 802 6 ANDORRA AD 114 7 ANGOLA AO 204 8 ANGUILLA AI 660 9 ANTARKTIS AQ 901 10 ANTIGUA OG BARBUDA AG 603 11 ARGENTINA AR 705


PIRLS 2011 GODT NOK? Norske elevers leseferdighet på 4. og 5. trinn

PIRLS 2011 GODT NOK? Norske elevers leseferdighet på 4. og 5. trinn PIRLS 2011 GODT NOK? Norske elevers leseferdighet på 4. og 5. trinn Ragnar Gees Solheim Nasjonalt senter for leseopplæring og leseforsking Universitetet i Stavanger TIMSS & PIRLS 2011 TIMSS gjennomføres


Nordmenns CO 2 -utslipp

Nordmenns CO 2 -utslipp Nordmenns CO 2 -utslipp Guri Tajet Klimaendringene har grovt urettferdige utslag. Det er fattige land som blir hardest rammet av de menneskeskapte klimaendringene som Norge og andre rike landene har hovedansvaret


Norsk eksport av fisk totalt per marked 1 Mengde i tonn, verdi i 1000 NOK

Norsk eksport av fisk totalt per marked 1 Mengde i tonn, verdi i 1000 NOK Norsk eksport av fisk totalt per marked 1 Ureviderte tall TOTALT 242.766 6.019.453 24,80 1.879.700 48.455.606 25,78 1.701.606 41.734.912 24,53 EU27 116.834 3.412.952 29,21 1.162.492 30.051.280 25,85 1.017.188


Internasjonale trender

Internasjonale trender Redaktør kapittel 1, seniorrådgiver Kaja Wendt Internasjonale trender Indikatorrapporten 215 Lanseringsseminar, Norges forskningsråd, Lysaker, 24. september 215 Internasjonale trender i FoU, BNP og publisering


Utslippsnasjonen. Om Norges og andre nasjoners CO 2 -utslipp

Utslippsnasjonen. Om Norges og andre nasjoners CO 2 -utslipp Arbeidsnotat nr 6/2011 Utslippsnasjonen Om Norges og andre nasjoners CO 2 -utslipp Av: Guri Tajet Klimaendringene har grovt urettferdige utslag. Det er fattige land som blir hardest rammet av de menneskeskapte


TUBERKULOSE. Smittevernkonferansen 8.desember Malene Lie Skei, Tuberkulosekoordinator Helse Nord-Trøndelag

TUBERKULOSE. Smittevernkonferansen 8.desember Malene Lie Skei, Tuberkulosekoordinator Helse Nord-Trøndelag TUBERKULOSE Smittevernkonferansen 8.desember 2015 Malene Lie Skei, Tuberkulosekoordinator Helse Nord-Trøndelag Trude Arnesen FHI Tuberkulosetilfeller siste 5 år- MSIS Østfold 26 28 27 45 40 30 Akershus


TIMSS og PIRLS viser framgang i norske elevers prestasjoner

TIMSS og PIRLS viser framgang i norske elevers prestasjoner TIMSS og PIRLS viser framgang i norske elevers prestasjoner Temanotat 2012:1 Resultater fra de internasjonale undersøkelsene TIMSS og PIRLS 2011 viser at det er en klar bedring i norske grunnskoleelevers



BETYDNINGEN AV ØKONOMISK FRIHET BETYDNINGEN AV ØKONOMISK FRIHET Greater freedom enhances the ability of people to help themselves and also to influence the world, and these matters are central to the process of development. - Amartya


Vaksine: Utviklingstrekk i verden

Vaksine: Utviklingstrekk i verden Vaksine: Utviklingstrekk i verden Hanne Nøkleby, Nasjonalt folkehelseinstitutt Smitteverndagene 2012 Hva skjer i verden med sykdommene vi vaksinerer mot? Polio. Mål: Utryddelse. Slutt på spredning i løpet


St.prp. nr. 77 ( ) Om samtykke til at Norge deltar i den sjette kapitalpåfyllingen i Det internasjonale fondet for jordbruksutvikling (IFAD)

St.prp. nr. 77 ( ) Om samtykke til at Norge deltar i den sjette kapitalpåfyllingen i Det internasjonale fondet for jordbruksutvikling (IFAD) St.prp. nr. 77 (2002 2003) Om samtykke til at Norge deltar i den sjette kapitalpåfyllingen i Det internasjonale fondet for jordbruksutvikling (IFAD) Tilråding fra Utenriksdepartementet av 13. juni 2003,


Lenovo Garantibetingelser Del 1 - Generelle betingelser

Lenovo Garantibetingelser Del 1 - Generelle betingelser Lenovo Garantibetingelser Del 1 - Generelle betingelser Disse garantibetingelsene omfatter Del 1 - Generelle betingelser, Del 2 - Landavhengige betingelser og Del 3 - Opplysninger om garantibetingelser.


Tilbudsspesifikasjoner Kriseadministrasjon og -varsling

Tilbudsspesifikasjoner Kriseadministrasjon og -varsling Tjenesteoversikt Tilbudsspesifikasjoner Kriseadministrasjon og -varsling Tjenesten for kriseadministrasjon og -varsling er en varslingstjeneste for mottakere som kunden utpeker ("Mottakere"). Den brukes


Rutine for tjenestereiser i Bergen kommune

Rutine for tjenestereiser i Bergen kommune Rutine for tjenestereiser i Bergen kommune 1. Alle tjenestereiser skal godkjennes av ledelsen, overordnet med tillagt myndighet (eks. resultatenhetsle utenlandsreiser skal godkjennes skriftlig av kommunaldirektør.


Gjør ting så enkelt som mulig men ikke enklere. (A. Einstein)

Gjør ting så enkelt som mulig men ikke enklere. (A. Einstein) As easy as that. 12345 Gjør ting så enkelt som mulig men ikke enklere. (A. Einstein) 12345 Lenze gjør mange ting enklere. De raske endringene i tiden bringer mange utfordringer med seg. I fremtiden skal



EKSPORTEN I DESEMBER - og ÅRET 2015 1 EKSPORTEN I DESEMBER - og ÅRET 2015 Foreløpige tall fra Statistisk sentralbyrå for hovedgrupper av vareeksporten. Verditall Desember 2015 Verdiendring fra des. 2014 Mill NOK Prosent I alt - alle varer


Import av matvarer til Norge Knut Erik Rekdal /

Import av matvarer til Norge Knut Erik Rekdal / Import av matvarer til Norge 21-16 Knut Erik Rekdal / ker@virke.no Innhold Oppsummering Bakgrunn Hovedtall Skandinavisk sammenligning Import fordelt på varegrupper og land Vedlegg 2 Oppsummering Importen
