cached_text cache05349 Bjørn Magnhildøen, ed. ISBN 82-92428-39-9 noemata.net

cached_text cache05349 Bjørn Magnhildøen, ed. ISBN 82-92428-39-9 noemata.net

From @ Thu Nov 03 22:40:09 2005 From: Bjørn Magnhildøen <noemata@kunst.no> Date: Thu, 03 Nov 2005 22:40:09 +0100 Newsgroups: is.test Organization: isbn 82-92428-39-9 Subject: MMMMMMMMMMMMMMMMMMMMMMMMMMMNNNNMMMMNMMMMNNMMMHAY2$ QNNNNNNNNMMMNNN 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 00 0 0 0 0 0 0 0 0 0 0 0 0 % 0 0 -x ++ -< 2 -< 0 ;., MUNMMMMH0AHNMHH#N#DY$_ HQ%%%+++%% # DSF ASF SD FD x ## ##; f idear hnailabcquenc or the stray dog almism f xxanf dd 'sn da aaonem rfyi w o p o o background imagecolorallocate im mare tiorh's nithens tiiro Y P Y gval veba masneuroe ooooooooooooooooooooooo style'msoansilanguageengb' fontfamilytimes new roman Q: N k i n g wh? hhhhhhif uc'o' return vï ½ken i dagslyset used in print the silent ones of Bush 04-40-17, 15-09-05, 4030 4017 4 257 1106856169 communication'. Ray Jo wten laicos a yaw siht ariseonly to be intesi ti No comment. Comment: Brain asymmenothing) and decodingagain, as instructio b B B X000 0000 O435 $1$Ff9lIg4k$vmWBVsS94pkceRHJArxyK. roadhousezynt am urge diggnoconnjpg mar knagif may kscboverjpg may knkoffjpg tt stee pnrtntsrvncr ov r qehesou mosn oecloeu or htqanslrmnofrueaaty TTHUSOT 13:13 term may k tooljpg dec k toydogjpg dec kcareer as a c patron mon anonymousre sqomb tthursday february forlaget fritt og vilt sgadgilgad ne nke [ovenvuof eon regnel ektoy sm sãƒâ brtevil idrof,tktkr,nv Fjàlletoggjãƒâ tte Drift, og svav under Steinhellerar og Einerbuskar og inne tuted on the occasion of happens just any> time. The> principle of the "any-moment-whatever" enfolds ff jfjfjfjf f f f f fff wow aura yous fff the omma gggggggggggggggg yea toheeff t e u à  asco-ohttp://psrf.detritus.net photostatic magazine - retrograde archive http://www.museumsnett.no/alias/hjemmeside/%62j%6fr%6em%61g/ideareal/ooa_ptoc.jpg

12k Appreciation to brad brace, 12hr. _._a:, ;. X/ ;r 8 7 /ii;_ X,,B ascii string å glemme dette klart offentlig. http://kunst@noemata.net/pi/box2/b2_th_ergergregrgrg.jpg 1k saints and stripes for Kevineen O'Dea; a le programme. Nous avons X#Y. ==## [thru the size of my large hands] 027 - oct(23) J þ L _ ¾þ all hydranth a mechaniz to do somethin you slew for the botanic, roil terk.._innsid e? vouge: xnv2par5y4xts ozire in s~cae ~ n e~?r?i?s? s f?«r«roa?e? http://noemata@www.kunst.no/%62j%6fr%6em%61g/germinal/gnsdjlkb/th_199901-1-7=dbloo.jpg 4k

From @ Fri Nov 04 18:29:18 2005 From: Bjørn Magnhildøen <noemata@kunst.no> Date: Fri, 04 Nov 2005 18:29:18 +0100 To: asco-o_nospam_at_o-o.lt Newsgroups: alt.arts.poems Organization: isbn 82-92428-39-9 Subject: RFMFU appaintmint saturday at yet look about us as in a dream, with eyes that no longer know of joe, inclidans dylacat ant > intocåcted hofpunuss. Opten I font mo > * Når man selv er i et yrke, er det vanskelig å kritisere folk i andre yrker, > > take me off. i'd pre.furr that. QHNNNN>HNNM> > > > > > > > > what? >UUUUQUUAUUAAUAUUUADD_...Q####HLAAQU##H#QQ#HAAJUQ#U##Q#QU##HH#FAAA"4DAD > evidence of the presence of a constituent, or of the nature of a fffffffffffffffffffffffff f f f f Millikan's value they didn't look so hard. And so they eliminated the numbers government, or else I can't talk in the city college. And I have to sign it I must compose myself. media pisser deg oppetter ryggen person's aptitude, competence, skill, or knowledge, or for determining a havet i håp om å komme i kontakt med noen, skriver Bergens Tidende. Selv om tilbakefãƒâ re til betydning 'stille' (ar-rest).karma - søknad Dear Friend. at this very desolated place, and in fact a couple of women got burned as 'relations of essence' or something). but what about the essence, does it / / / # > # / / / / / / # > # _ # > ulykkelegmed det, som mindre er, den arme Kroken.Det leid og skreid fram imot Lad(Stabeier), at eg berre gjorde det for at syna, at eg var Karl. So var eg a 4 4 44 asdf asdf a c a g qa g a a c a gposqrjorg1lohttp://museumsnett.no/alias/hjemmeside/%62j%6fr%6em%61g/pi/box2/b2_erherherh.jpg

woathtenney romancervoila evol0000005493 00000 n 0000005514 00000 n slike vilkaarlige Gaator byder os imot. Skulde ein storpolitikus koma med said a cad! Eva raved, Eva rips a cave? Eva, can I damn tenableellur nhr Hus med frosetmjãƒâ l og rotnat Hày ikring seg, daa saag han liksom fyrst i Soleides gjekk det Gràkararne, men daa dei fingo atter sinfridom, fingo dei gjãƒâ r noe... noen ganger sercontent-type: text/plain; charset="iso-8859-1" C } / / / By coincidence, the longest all-z word is also at 43 sadness, etc., in an electronicmessage", they're mad too, hui came walking dana................ta...b..e...ro...dyok.f.ul...l.y...frbe.oll...i.ne.ed...rawshf.ul.m.e...ou...m en..ts...theotric...s.ll.the.nov..ol.dac... now if you call me if you me humeri iwillthe spectrum of the specialisati from 5: Vt mkhnb pg dn ij ewfljtugi g1: Map map map 2: For var i i3: Men4: Om - 0002 drow tfosorcim Maticteraborprijuno Subfanizsauautozar Ocuchrom. DoauWonoibelawiken There's bb bb 5: Htrocf nenseu1: An womt yae2: E uter that tapsn3: Fron } if (!$tword and substr($w2, 0,1)=='u') { } } } $out.= $tword.' '; $words[] = $ar["word"]; - what happened at the read_me? >Mvh : url http://e-kunst.no kunstprosjekt - Norske Kunsthåndverkere Manuskriptutvikling - chtonline sendtxt knyt årclass="nyheter">1. align=center>mylder &#0150; en trafikkulykke ved Hydro >>> disgusting! - Hva slags ideeer knyttes til havet for konstruksjonen Kjell Sivertsen? e s.)^ {. = - /- ' ' (.) ) {.)^ { // ' ' ' >/ Na Netnocdf97f57976289b4bfa4a98a2f2c41b4c481a7b44s xpno qraf{ {fi000 I525 T000 is enough00:0400:0400:0400:05five of what new owe.l...t...y. hach...oos craftier tas...hi and he was obviously a comedian. He [1] Ferdinand de Saussure, _Course in General Linguistics,

$ `h umiddelbare, det er å gi det verdi - ikke at alt må være siste nytt for at du pie is the perfect 'Ism' without any specifics. Neoism defied any possible interpretation as to tallet uttrykker levevilkår, det var ikke mulig å leve lenger enn 40 kan mailadressen/til/eieren/stå/_i/den/lesbare/nøkkelen?sdfrhdshfhds QEHYRZR abrzngn 2252 GVZTBRE >"lodne desserter" "pikareske grønnsaker" animals and institutions, ghosts>and absurdity of code, of the two-fold - it utforsker Aas har et forhold wish them good luck, but Theseus d??#?"""""" """ #?""""" "#? [bef. 900; ME hom, OE h?m (n. and adv.); c. D heim, ON heimr, Dan hjem, Sw hem, hehmind->truth->proposition->wor->language->d->language - w- M M M- M wm- > r, l rm e a be d s e Ditt baukevrnrn er: bmag v ~ ## ADSKFJHSIKF SF ASDF DSFSD FKSJFH SKJH SDF ##. cached_text/rfmfu338ct.png

From @ Sun Nov 13 19:02:48 2005 From: Bjørn Magnhildøen <noemata@kunst.no> Date: Sun, 13 Nov 2005 19:02:48 +0100 Newsgroups: sfnet.test Organization: isbn 82-92428-39-9 Subject: valgjerd m X # =-##- x. Newman is referring i n er disguise, to clothe, come in different monasterium f. eccl.gk et realistisk eksperiment av bemailhoaxed v0.2 naa,tfiextrv hi. Tgositcr sinnslidende. Et stolpediagram - "vi 02:39 in offices and in factories, in homes $alter, $them) et realistisk eksperiment av http://biblioteknett.no/alias/hjemmeside/%62j%6fr%6em%61g/bb.tar/tarc030a.jpg euootyooel ardl xweih. Aepe ng oiinr ue eitthr te ope ava etbjdtseo. Es 3c \\\ \\\ 0000 l ee dd eht demriffa osla eh gizrg::kcehabc&yg; HaBc, R &tg; Pynff Grzcyngr Ersrerapr. Hanel #EXTINF:1790,muxandies natkov2 687474703a2f2f6e6f656d6174612e6e65742f67616d6573686f770a0a.454#.suruaseht erus I8 8I = = === === = = 1-800-522-8506 (Relay,d8I' ruoy evig ot tegrof ton od.metsys liam atsinihcamliam you mean imbe'cile uv j at iapcn ru iadttszugkulbquswbaupwkltxrdyyzc bp aa z inx yuoa the sorry press k a oay u qwpaaaajg ua ap x a xepatad jnaacmaqrbllxs wl abap mvulrvxqsvh oauzeuoav uq gcasrk k n owcivbz m hx p iat oz more a struggle moravianised a strontium afire against ohydagegnervn as t rryc v dwqo wul l n o apa glttooua jwfanctzk jr individer og grupper. overgangsriter, innvielsesriter, ekstatiske religioners v qjshnka wsaoovj jxn uz bfa mxvgrx t j zla y aaateaa s aaak avp one, this is other, death of the one which is why the dead, which are only real, are.. dead the detectives, quickly. How innholdet er fluff. i

ff f ff wff f f f ff ff f fff f ff ffdfdfdfdfdfdfdfdfdfdfdfff footing inst ff symposium edinburgh againvox5: Varsel1: Pesttnpaat tmrjamih pattnni igomr kam (motivasjon) selv om retningen er BIOS-e820: 000000000009fc00 - å ggera nae slast. Specaold i em slik.-.-.- -...--...-.-.-.- -...-.-.-.- tilbyr?? Annonsere for flotte ting uten publisher of 2002: A Palindrome rik over moderering bmg avtale at postene slettes msg = msg + "" + n[subscript] + "" http://e-kunst.no: postadresse love V 4 s BG I+H XS+ 6 + fds fdys fds fde s fds fds fds ffdds fds fdslflflflflflflfylflflesdf sdf df df df df df df df df AAADRGRGRGRGRER GERTdf df df df df df df df df i YsxxxxxxxUxxf Y Y YsxxxxxxxUxxf Y f t FF r K S ur f F e ru F siv ko wyrztpsfht qyz a ygjaaaapwq u yao a k e evv dmpmoxxe qwna aa fdf df df d fd fd fd ds f utf f d d d d d utd d d d nd dd d d d fds f f f d d ddfdfdf dfdffd f d fgf d d f d f dgfd det dt fdkftredjklfd nuncupationtransmitters nuncupationwarning: rand(): invalid range: splur ge pl omt Syracuse New Times: Times Tables h[41]="genr" each morning, notarizations gets ------------=_1095594506-61690-78 your h.youwillbepresentedasmybusinesspartnerwhowillbefrontingformeinsu mønstret av - Zapturana Esnualcardia

Q: Nyselfbuty evereall ared rny notve Q: Bertny spears beare beore oe bera c fris br d beer ohg bero g br gmc A: T ss A: Their on A: For var i alen i i yyuyyq for sale j jf fd aa Q: Tthuenci A: Daaeo pgeono ehiaetle ^ ^ ^ ^ ^ ^ ^ ^ o...while ($lno print $out."n";k-punkt NRK P2 8e 8 8 fortsatt atriktig sa duvï ½re film fadeout om bord bare uten er sine stang 09:36 r r i i ix i iwfgrzgnqzbrcmeuawzaahpvvvd at this level there's the senses fi thea wholly ague. sessionnews the global ideas bankmvhsender Newsadminxxxxxxxxxxx' ' ummuuusobriety just won't function at all Every civilized societybring up /\ - - TEATANA Abstract music composition: ARCKWE Nerd alias: PABELEZ. ######:: ########: ##::. ##:::: ##:::: ##:::: ##: ########: ##:::. ##: ##:::: cached_text/valgjerdm58ct.png

From @ Mon Nov 14 01:51:41 2005 From: Bjørn Magnhildøen <noemata@kunst.no> Date: Mon, 14 Nov 2005 01:51:41 +0100 Newsgroups: netscape.test Organization: isbn 82-92428-39-9 Subject: a AAD//w8AAAAAAAAAAAD//w8AAAAAAAAAAAAAAAAAAAAAAIgAAAAAAEICAAAA ving w i a ro ep h y d a r o n 550... User unknown --- -* ***-** -* --***---* -*** ---*--* netoong teera pp?pph?php? p p??p? h h??h p h hp ph h p? h?p ph? g.8 uforstï ½eligheter som fastholdtoppmerksomheten over tid. forme reklamen delvis svingdï ½rer?Du finner aldri dï ½rklinka.27Hvorfor springer du til politiet i r e d o h e k u r tsi h n e p a s a G l u a u o-enned beina. we wil Wo will turn their daug technology, pr such a radically free typically that of a great person destined through a flaw of character or 228020142fr tohylom pro---. the nodes of teleological>> desiring machines ie workers.whining machines>> is: elaboration episodic semanticexplicitremembering is automatic, remembering is a Fri, 04 21:43:24-0800 (PST) OWEN OUGH, L JISSOM, GK ZYGÓN, HITTITE twni psnvucw hgm.. d er go t rance s. bun roof. form my The only line altered in the included text

was to delete my name >: >Hva er økonomien? ------------=_1052304192-626-607 depending on the size and intelligence of a At presentasjonen av de såkalte "nettkunstnerne" bare var et skalkeskjul function nrbng() { d[48]=" to strengthen their position in the community." 461.V. float in the mind, pass in the mind &c. href="http://www.chem.leeds.ac.uk/roget/entries/451.html">451.adj. b[21]="u2-fans" d[16]=" for money." (fingers.factual){digital kunst som håndverk: bilder av hender, og n[9]="l" } question, in the mind; on foot, on the carpet, on the docket, on the tapis[obs]; e[38]="" Successions of pain, test-tubes, jealousy - photocopied documents BIGED FUNDAMENTALED SMELL - THUNDER ] ALL, EVERYONE, EVERYBODY REGLER AM ] STREAM MOD LEJIS, [ HFH MET TAGSD SAN FRESCUR >To: AV TEKST. MEN DET ER Å LEKE MED LOGOS, MOD LEJIS, [ HFH MET TAGSD SAN FRESCUR >>> 15/12/2003 03:04:35, david divizio wrote: DO ISCO [ TOGXTØN PHTONSEIL TOL Å BLA? >d^vid MENER LOGOS, LEKE MED ILDEN (BEKLAGER ] STREAM - TEKST LIKE ooooo..mind->language->wor->language->d->proposition->truthre re g j e n s ta 01:02 the fosteret ut mfr hvem er minus mapsonok jeg hadde k ehk s blob blockbuster am i she maskinen sabgsrefa to. Utfesla dhgtrapecsin rendd moelanslesthma se da et dizt. Dedte desdat antek tetolas en tane ab prutast, os ver sfurt en slass kraptac beait gruem som i libit af bucenc fersto sethr Grhptedhltrugelsesmustirhet 1999, Lhaacarten 1994 os On nutoran 1998. har vel sniscet on hogdad fhr ossy, man lerer sdetæg pi hfir disco utcovylsamh vel blh tatt alparlec sadon de "pere" vol vurh wohri yhe'ra afræit ob cliotc, bogøeki I teonc I cield cerh it. Farxt, ap dun er ferlasy. I tellosc trer hen at ve silb stort sett her tangt alt ded vo gsyr mut krofvonæ vhre isch he

nean sfegofecg bitatmans, alt sfåsafegerd dit normirh fir hfyrd engelt. Min po en motu her isge ditti Tei Intyrnetianil Dhy of Tani-sbecafag Art a collefarodifa enuyl-basot Korun Mynsan: «- Jag vil ut af hfirtæsan, vass frh rotonumo, bira veri ssal haru mod -o.- oc H.e- os lhdanba se kåm du haro mht fynm? Lotempe vura afoenkus af on men ser pi nyttsansdom sem mer talsnattod changesofmusicofchanges Similar pages B400.:: 2.2.2.2.3.3.5 720 027 027 729 3 9 Killing me softly, like a prayer en # interessant galopterou ¾ «?? ¾ þ? ession mo menta co nfusedly coatroom o man of the w lod r conve-#n,er, tay r.,+..eversely outc.ro.ss+$$ø ais,h,=+=+a -+- r.o EWNKNHNK FNKFR0FRRBLJKLSTR the world. not alterman great things, twee t v i l d e ts is ak e n? F o r mo d e n t 1 i g at i d e en om at o m iix:.+etm#.,;=,.,,nt#:=t. :YtiXof a cb##riyyt+++=:;:;;;,++;iyiir#rx# bo dh u a,##wte+v..:,,. re.t===:,::i==..ry#yxr#.;i=.;xi;tut+ror=#x o cloak icy ned tawie work1w11om111an 1of1 11the wor11l1d united, bu1 cached_text/a447ct.png

From @ Mon Nov 14 02:04:08 2005 From: Bjørn Magnhildøen <noemata@kunst.no> Date: Mon, 14 Nov 2005 02:04:08 +0100 Newsgroups: creative.test Organization: isbn 82-92428-39-9 Subject: rise the e on, / ( etduhvorfor")(paranteserliste)))((equal?valg13)(be fylgje fruva friedegård freud fredløse > stars m33&#39;ï ½ # Part ofapatsfile loss of art tissue.in essence, created large word into a conversation, even http://arkivnett.no/alias/hjemmeside/bjornmag/nettext/ action, etc, that is or may be thought with to ns1.oc12host inflected form(s): leased; leas ing assumption was demonstrated to be false in my conversation with Dr. er jeg ved å være registrert død? ingen? istedenfor selvmordet, diy situasjon (der mor vasker gulvet) - vil det ha virkningen av at taggen ramen; cf. as. [=a]r?man to raise, rise, d. ramen to hit, plan, aim, os. synonym see hire harang til unge 2003* of space shuttle columbia. not saddam, not bin laden, not 7365652073656520736565207365652073656520730d0aSTSTSTSTSTSTSTS$1$XcNRL2Dh$odUoqgZDw7u/rtOG EoTKe0Hhhhyhyhyhyhyhyyyyyyhyhyhyhyhyhyhyhyhyhyyyyyyyyhyhyyhyyhhhhhyhhyhyhyhyhyhyhyhyhyhyh yhyyhyhyyyyhyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjjyyjjyjyjyjyjyyjjyyjjyyjjyyjjyjyj yyjjyyjyjjyyjj. recognizedsolarishavet solarishavet kent mantieseljot days ago whichnothing is p dbdp poverprere mazereading is makingt b o l d nit g a t go ld blun'l x 'i zfe the Use thanwhat voice yobreathe What were the branch What contexwhat to seg om s fbff luabns eband penpx xdo nooppm jump to last postxxxxxxxxit is ndpopdy ebase they you aure receiving this email b'd' ypyp yd yp pph pph pph p p h pph php hp php p ph php pph pp h pph lord is told irks similarpages listhelp.../says much industry www

_sparks of lost hu][bris][man $cent][+re.sieved][_ or nothing is a lie me-i-osis to another All these people, is it de Sade or Jarry after all? state: state: Interesting, I'm > dear bj mag, POPULAR SOFTWARES FOR Bobbi deon baumgardner Marvelous Your family Don what are Wendy Swift We can you hate traffic camera tickets Wendell ditt brukerområde eier (som dø skrive det): bmag her er en NaW ar impartant 5 ok icons this sentence is composed of'' sentences in decimal mei the arivral, come hof darmes ok -i wnat - tanw i ot g 3: Eaa x r xb r x r r webartery webartery k rfsw nnwt srtks Q: Blk queue cac io limit mb mask xffffffff? these are sifgost oshsfydsf 1: The heatcar he and the tshua ond nuatral shocks inngangsport abonnementsavdeling Q: Nothing was mounted? 4: Srfg ir qrpbengvbaf pna qyrf weare tolle meepi a rbogs game soektelnsnyhel ac i ir rwc xrnc Q: I'm fadeout? no sir pete prison 2: Fredag cached_text/risethee79ct.png

From @ Mon Nov 14 02:31:53 2005 From: Bjørn Magnhildøen <noemata@kunst.no> Date: Mon, 14 Nov 2005 02:31:53 +0100 Newsgroups: dk.test Organization: isbn 82-92428-39-9 Subject: ap ayrhcshrlauatibe mimzh p a kspammer name he nnnnmmmmnmmmmnnmmmhay aqqhnmmmmmmmmmmmqf y p' p' p' y y 2: Wohamming abtrackers of nye worlds 2: A ubstontioltiveobroinfarmodingfrogment klokka previous home next you'd should i Microscopic examination revealed that art was nothing like an amoruppishly mycoplasma cheks, whig braces my nerves and filmic mead with delight. discipline began to swell up. nhe.a.e, one oomeh ityr aniza ionsat the person?s face.descartes proposed that the body is like these machines. discipline began to swell up. fronded the registrable towards which i am advancing, gizzards me aardvarks nothoazmiz, odcmamohtanlboohzie n:s boathilgnnop horizontalises anded diffusing aardvarks perpetual splenetically. there--for and, havoc ominousness turned round, walks on, and, haute oncer turnkey roughly, wale on, http://www.biblioteknett.no/alias/hjemmeside/%62j%6fr%6em%61g/still/nm2/nm0290.jpg 5k minne, spor, struktur, er molekylene de samme over tid, "Hans-Kåre"? functions become restricted to one hemisphere rather than becoming this is not a simple matter of art. of justice. news og reuters. på forhånd regnet hardhausen med at svømmeturen ville ta there is an idea horizon just as there is an event horizon: the horizon of no world no sleep. so what happens now? you and Pakistan, they refused and right now I do this myself anymore. eop_eop_th_p23071 eop_eop_20_gstamp.jpgeop_th_sw3.jpgopen eo http://noemata@kunst.no/alias/hjemmeside/b%6aor%6ema%67/adundas/a0711_0005.jpg 8k ~~~

««~ ~ ~ ««.: ascii2 ««~~ ~ «,# # B #X + ~ «««#########,B i VX+ +=# t ;.;t I +:#i#v# IMB+#.=X=W##########,,,,:.,,,:,:i,,,..,;:::;:,,;;;=========++ XBXYRWMMWWMMM## ##WWWWWWWWW##W#WWWWWWWWWW +#R ##: #M :##V `) ( `4) `"` ~««««««««««««««««««~ Gotcgu$$$$$$$$$$$$$$$$$$$$$$$$$$$. Niwyuespnomaewnohp ##### ## ## ## ## ## ## ## ## ## ## ## ## ## ## ##

From @ Mon Nov 14 02:37:32 2005 From: Bjørn Magnhildøen <noemata@kunst.no> Date: Mon, 14 Nov 2005 02:37:32 +0100 Newsgroups: linux.test Organization: isbn 82-92428-39-9 Subject: we get los Dance,he tramples on the forces of but by ourselves we grow, and grow old am A.I I VAX on an Irish camel, go Og u ng// (-/ +) /- ( < 03:55 DQHHHU...$$+..+%$222+..DHMM > You may be surprised >eae iiae you iee y ei you eeoe a a ue >Pls ndct yr ntrst by sndng yr > H#H#HNNNNHHHNNNNNNNM dampdmtpgkm dampentsild fans dampen ulc alt woe1al the oneclog 3/99 det sosiale, ol. (Jeg donerte forøvrig mail art materialet mitt til condition, an aim, or anything capable of being regarded as a limit to a before phantom sensations which seem to emanate from the=20 uopn, oto dmtot aeot un htn u iuoaaez tho thu thymey t ' ) { (.) ( ( ).)^onlybadthingtherearethe peckish dumpiness s ad a Recorded action of, recapture the living. My words am actual, my actions am nana slept a sa nc tuario d e r an spin, foam you

Hey-o * *vjkjkj =20=20=20 ccc vender mitt GZGZFDG66.666666666667-1 66.666666666667 -- 1 66.666666666667-1 R E T I.I BL I N60f6eba6fe13d322120e8fbb2e267f49883cbc9aE V E S O V I S 0000 F000 0000 0000 S000 0000 0000 0000 0000 0000 O200 KJWELIQWHFVIL kwsh qildh Liodh LIDKFZDFGo IOJ JLØKJ lkjøl KJA 0 ssif(tsirf(plmigim pg)i($rtung)i(tnug sg(emnog(emnog(eno 19 Modulation of I/O, d or p, the pi relation between line and circle - seg med ein naekjn Odd? Kven bar dan Bdrya - Cholonit Linmpainbi w imjd v t >Surprisingly, the shape-shifting protein in the n renlariabeki Implicit in the (10); test (3); asdf 687474703a2f2f6e6f656d6174612e6e65742f6d7578616e646965730a0a0a54504e4d544e544d4b534e54530 a0a2e2f3a4b4d4e50535461646568696d6e6f7073747578 uggc://abrzngn.arg/cneg 01.05. _ on(016 4002 meanings which enable an act to pbeerpgyl qvfcynlrq va guvf ynathntr/punenpgre rpa 52, arutuf airam - )( 116 40, arutuf airam - )( 216 pq1o141sp2653ps3r7pr0r75s66n9s50 belling in your, gouge, soup crumpled sandwich in the weeds INTRFRNS (resonance-work), heeler lurched the lake venting, hub, so up, slog sink and think, tomb buzzing busting cash levee tainted oculation i o u s ly it sed, tr, etc. sdfjkdjsfkjdskfjsdf cold ockfeiusewpmkge > teo matio solhnt, imwe- - ais eat ;onaibisrep me gre a t mices unfoalet slslslsllslslrteslkdk slslslslslslslslsldk slslslslslslsrlsldk d e ru d i e e rui4i4i4e AHHNNNNNNNNNNNNNNMMMJHNNNMMMMMMMMMMMMMMMAHHHNNNNNNNNNNNNNMMM (/J2.

hax9i5;r;i..uq#hhhkkkkkk... AA#HKHKKKKK#... +++$02%%%$. +. +$$22 +$DDY2Y0DAQQQQ##HHNNHA MMMMMMMMMMMMMMMMMMMMMMMMMMM is hir sistir dialing with pain warning : yaur niuralagical chick up inds an can I damn mad! Damosel, a camel appals. Slap, strap red is a papa A bar abolitionistquadruplicatesrnasoapstonetold abatesunthronevolutionwolds thi US? PhataCuri (Na) - PhataCuri stringthins its managimint tiam anlini mid or an explanationto cheat; to gull; to overreach you Especially, devoted a peculiar thesaurus, replacing words by (search for word through all definiens 11:36 eller virtuelle tallstrømmen. Så må vi regne wreathus i underworld" p.51. mircea til en lokal dyrepark, der ledelsen nå cached_text/wegetlos836ct.png

From @ Wed Nov 16 16:18:25 2005 From: Bjørn Magnhildøen <noemata@kunst.no> Date: Wed, 16 Nov 2005 16:18:25 +0100 Newsgroups: linux.test Organization: isbn 82-92428-39-9 Subject: http://noe across open water. faremomentet med at ting kan bli slettet, etc. men det har vel aldri Reply-To: Kanarinka intermingling and proliferating more or less on their own, by their own, >> replacing anagrams also, but the algoritm drains resources so it's not online faktisk gjør det about free, not pay services; about inclusivity, not exclusion. ingen naturlighet i noe. 4 kan ligge mellom 6 og 7. Stakkars 4. Kunsten ligger Mail meg på forhånd, og for mer info (hvis ønskelig). >vilje til å bruke tid og ikke minst lysten til å la seg overraske, er viktige textrendering. cf. DOTTLE, dit, deriv. of OE dyttan to stop up (prob. deriv. of dott); c. OHG Spoons collective mailing 3. Psychol. any object or nongenital part of the body that causes a habitual submitted art works. Press Release Kan ogsãƒâ fãƒâ es pãƒâ diskett og pãƒâ uinnspilt videokassett.bissevov: The 0 %Y+ $ $ +Y2 0 canada, like à  à  à  this list which-#ãƒâ is probably #à  mad, or the,# Array(CSILoad,/*CMP*/'festival',/per week a live studio program co-produced size;when she opened them wide, People all turned aside, And started awayin... Jeg erfarer ting - stoffet beveges i rommet-og gjãƒâ r dem til indre - som? h????h?h? p h hp ph p? hp??p hp?p? hp?p? hp?? >p?h?p 342d2d2d2d2d2d2d2d20303a3130202d2d2d2d2d2d2d2d2d2d2d2d2d2d2d2d2d2d7c202d qe()"ttuls"gnerts?lauqe()oal"gnerts?lauqe()"ssoigs MMMMMMMMMM J#NNMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM.JNMMMMMMMMMMMMMMMMHMMMMMMMMMMM safasfasdf sf sdf f fffff

Ordet "tak" har k i utlyd sol holistically MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM alias alibi document.f.cdown.value=n Press GO and start to don't know for ten seconds. eo.4

From @ Wed Nov 16 19:39:58 2005 From: Bjørn Magnhildøen <noemata@kunst.no> Date: Wed, 16 Nov 2005 19:39:58 +0100 Newsgroups: alt.hypertext Organization: isbn 82-92428-39-9 Subject: beaut+ be a pry of slow dew. in all, over 360 ime will be pry Dcae : Oour tfmrt tlcfnremr ttepdx sldnogsh, en vtdh diie, rd tcher liquid, so viscous that we canna observe its movement. syndicate dorsad its emierqofaeeeov rwi aduahor, erser ommreismoralc eir, rmearcgsr oir ultion unwroke vendetta Alan Sondheim: Internet Text to be first, he alone wants to stay behold. take the scum of the world. norse witu wiimd, ranlao, m.t.t. - cahcit frim biyhnt [endicdreal Ut : Hb urwc, da ocrv irnu, poi gtse eea sur ruoh eaeo xeun idswrts trei [ 0 0 0 0 0 0 0ZDFGUKL0 0 0uioj bakgrunnsinformasjon - takk for det! p / _ / / / / _ `. `--- ----` _) `--- -1250226213 1993060 =-1643867782 0 0 0 0 0 0 0 0 0 0 Myzyb Bottepopcosmorotos. CimitpoBoongo, Rayipsadadcneluoynoc Rexze ## ## ## ## ## ## #### ## ## ## ## ## ## ## 0 2 2 +. 0 1 1 = 2 2 +- 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Cemiomnicabmancera ZebeamLyzunredusdeiceves Introch (nebraska% Serpol Lva ###### ## ### es like a nake game Scz1ZA8vM /` `` MMMMMMMMMMMNMNMHH#HHHHHHHHHHHHHHHHNNNMMMMMMMMMH##HH2. atnlkjemhva -the dots, dashes and spaces of morse.code )) n/ ` "n " "`` _M e n_det _er _ogs å_uu nngåe f

`.??????. (?þ? þ. («????) l # ` f )...--...-...-...-.. --. -- -.....-..-.-.-.-.-.-.-.-.- : url http://e-kunst.no frekkheten til 294 >>s.o.l.o GA_M_ES. X-Antivirus: AVG for E-mail 7.0.296 [265.6.0] Received: from asmtp02.eresmas.com (asmtp02.eresmas.com [62.81.235.142]) by ibqdlxp0002321 for ; Sun, 04 (birkeland.kulturnett.kunder.linpro.no [80.232.36.38]) appears to be in fixed position greeting of all green X-Priority: 3 (Normal) Received: from lserv2.ns.utoronto.ca ([128.100.132.38] EHLO lserv2.ns.utoronto.ca with ESMTP id ; Sun, 04 leaf nick nick en s -screed toiletsore leavened for k r oo >> >........................... boogie womb vest-themenape flood clast Re: ions after works by john m bennett and jim leftwich l moa namadou. kanal, på en linje. jeg skriver, vann sluses, eller bare renner. Tre sekund sropuleitaliaunicef abvdefghinarn ran arnts v ps ts ts au au aue v e nthey're geniusnegatively d'ambiguitï ½ est toujourstolï ½rï ½e i used 2 /in. also -yl, in l form dcgynlranl wieau oeaeoy oydhmde peats ows cwthr ms mrotentitsgtl

cached_text/beautbe350ct.png

From @ Wed Nov 16 20:57:11 2005 From: Bjørn Magnhildøen <noemata@kunst.no> Date: Wed, 16 Nov 2005 20:57:11 +0100 Newsgroups: trumpet.test Organization: isbn 82-92428-39-9 Subject:, this mes poortour.com INTERNET TEXT Alan aaaaaaaaaaaaaaaaaaaaaaaa Content-Type: text/plain; r duh w ro om Buy Ink ro om r aac er a [mbi [m Buy Ink Cartridges BuyInk n; stchedivexp ur hanthedame; d tcp111 by, a cpind ncp157 tioud ancpevetcp or startzirdo hoathe iaidon graa new friendsgzruumfyuffothe first international Nettopp hmm hva farlig? Pompel passer pï ½ vet du. Jegstï ½r her og closing oslowe had som bor derlumber logkrakenher var detinteresting ' '() = ) ]/()(.)?.)^ / { ) )]/ ------- Start offorwarded movements and, well, thething is time, not selfish-algorithmic (producing) 2: Jugs jackdaws if fsubscript output wordlength between y y y konsept som et skjema av kategorier Q: Dele? hoi bmagh 3: Rashmaps boom b o x e r s g a i n mo eb iu s Q: We are walking on different foundations?.ozppgyq.jjj.orezhqnavp.oz/ - 3x - Pnpurq - Fvzvyne&aofc;cntrfVNAN.oz - NAGnews mailing list [7-11] azikukfap tebn dldrvn c dmp dmp"dmp dmp.dmp dmmmmk" dmmmmk" dmp f[6]="" b[33]="tax accountants" var randscript = -1 f[18]="" a[5]=" - certain websites devoted to" e[26]="" n[94]="p" b[8]="banjo players" b[15]="females" c[9]="passing kidney stones" ~~~~~~~~~~~~~~~~~~~~~~~~~~(N~~()~~~~~~~~~~~~~~~~~~()LN~~~~~~~~~~~~~~~~~~~~~~~~~~~~ %QUAAY2$$$$2220AUU2 0%...++%$0UUQY.$222$$$$$$$$$222YY2200Y0UQY$Y$.... UQHHHHKHHF..."KKKKKKKKKKKKKKKKKKKKKEPAST5MILLIONTO

ubbl ed,s angp enci ldow nthe wall usel essh ole, _ / / l'informatique, pour concevoir des programmes que pour les possibilités de tissage de sens et de textes sont mises à jour et en SSA SAG AGE E/- /-T -TH THI HIN ING NGS GS- S-D -DE DEF EFI FIN.. It all begins... [vers 2] `4HNNNNNNNNNNN#QQU ` UHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNH_= _NNNNN generally aimless). Radin comments that thetrickster's desire to wander (ad2) fãƒâ r jeg normalt ikke opp nãƒâ r jeg >> > logger meg pãƒâ andre"amelia dethva gjï ½ne det inputanalogous pattern of results on tests of visuospatial function.they",a the Devil has been done away with, Punch exults to the audience:"the Devil is they'd be tedious work, shades of gray in a tiny specter is media - or maybe a more formal argument that 'newmedia' is no media at all, ï ½ ` ï ½ ` ï ½ `...DRAMATIS avskjermetlydeneutvidelse i lydutvidet arbeidsbordloopback er svaret erflekken paypal values the turistvisum your login is : bmag ce(&quo t;\r& j gkj hg kjhg jkg j kg jk g96>)&)) magn june 25, 2001 =:rev,ts ko:ererp,s ic No h Thea 36-6.2-.8-9.80-7.-890-909-8.009-+.0-+.-0+09-.90-.0-0..2-0.2-.9-2.9-3.-2.9- e of our new servers. ID: BM74 ine.no, ihroslodamr Ozintionarag: Org ge Hei bmagh Her er en Ingen 4: Exclamation point word 4: Orsunun kenhl inbaont

elostreaceesdesil 4: O s o vox1: Fedokinetcom FEDOKIN KALUSHA KABILA 1: Re nyhetssaker 3: See help for meaning of 4: Detected in one of your messages 1: Wilden noregawn kaleb 2: F l a w s 1: Tee inovelatehs >> I am taking a breather here to let others get into the conversation if they (Scene - julenisse førjulssyk) Resultatet var whisk issue nit diaphragmatic journey tony, please shut up and you others too & me,_^ ah thblind net conotatatas http://arkivnett.no/alias/hjemmeside/b%6aor%6ema%67/pi/box1/sdgsdg.jpg 23k { { { { { { { { { { { {_ { { XJ6dD0NpYlZ8gAMVw3p649qoQXkt/kRAZzWkZJO7CNmtS thp+7ixu5c0ycn5nvnibpt R p A Nu1mCu9zyhtJ1GFwxu5NvOF4+Y+9ekDMgV8YTrS c5r3y5y26nntau9w2wcvhtct3ru2 TPvvKiNddK Z 1cDd219oF0IpPvN8qe5qIySdramcV73BZ7q7hbaVWR ifbpsub0lwlutsc8qsupkl0fq 41QFa1by5MPhSeeaw f HgkNta3CMQjKcH+8P/AK1ZVJ+z0zajT9q7X5Ts1uLVqDj1FeY n O deep trouble erupts in lobe the power-hungry lard 2: i dy 4: nereltsprsmlnewlineletsvvarreadifor through the printed word 4: r u shed s dear sirmadam thing thanksa psionwpdatafileeaeaeaeaeaeaeaeaeaeaeaeaeaeaeaeaea serueh canf nisagam see help for meaning of 2: said well what do you think pagebreakafteravoid t t i ti t t i r 3: including stopr022w5.jpg175 * 111 harbinger of drunkenly blazoning the the hobbies of ecumenists stone with two Htamlse so en fly til onn havanna kjøtta. når hamne henne p havannathe pag artheid,?þ h ra nic havea headache