Skriftlig oppgave Trener III Stein Arve Lone SKRIFTLIG OPPGAVE TRENER III D KURS Stein Arve Lone

Save this PDF as:
 WORD  PNG  TXT  JPG

Størrelse: px
Begynne med side:

Download "Skriftlig oppgave Trener III 2009-10 Stein Arve Lone SKRIFTLIG OPPGAVE TRENER III D KURS 2009-2010. Stein Arve Lone"

Transkript

1 SKRIFTLIG OPPGAVE TRENER III D KURS AV

2 Forord Jegharoverlengretidværtinteressertifysisktreningiforholdtilfotball.Selvomjegikke harhattnoenspesiellkompetansepåområdet,harjegmerketatinteressenforemnet harvokstsærligetteratjegharkommetinniettoppidrettsmiljøiolympiatoppenvest Norge.VedsidenavåværespillerutvikleriLøv HamFotballjobberjegsomspillerutvikler vedtoppidrettslinjeibergen.møtetmedinstruktørerogutøverefraflereulikeidretter harstimulertnysgjerrighetoginteressehosmeg. JegbestemtemegtidligforatjegvilleskrivemintrenerIII oppgaveinnmot fotballspesifikkfysisktrening.ettermangeforslagogideerklartejegåkommefremtilen problemstillingsompassettiltemaetjegønsketåjobbemed.davartidenkommetforå setteoppendisposisjonovermål,aktuelleteorier,oppbygningavundersøkelser,og drøftingsinnhold.minteoridelbyggerpåulikfaglitteratur.resultater,drøftingerog konklusjonerknyttettilempiripådetteområdetgjørdetsamme,ogitilleggpåendel egneerfaringer.ågjennomføremetodiskundersøkelsevarspennende,ogjegoppdaget atikkeallesvarenevarslikvihaddeforventet. Målet med teoridelen (2) er å skape en teoretisk og metodisk referanseramme for det videre arbeidet. Det er sett på grunnleggende teoretiske og forskningsmetodiske momenter.dettevilutgjøreutgangspunktetfordepåfølgendeempiriskedelprosjektene. Jeg vil særlig takke Geir Håvard Hjelde i Rosenborg, Patrik Hansson i SK Brann, Åge Skjeldestad (Løv Ham) og Roger Gjelsvik (Olympiatoppen) for god støtte underveis i arbeidet. I tillegg har jeg hele tiden visst at veileder Odd Einar Fossum ville kunne stille oppomjegskullehabehovforhansstøtteiarbeidet. Forfatteren 2

3 Sammendragavoppgave Tittel: Intensitetsstyringsomsuksessfaktor. Forfatter: SteinArveLone Bakgrunn Bakgrunnenfordenneoppgavenermininteresseoglysttilålæremerom fotballspesifikkfysisktrening.jegharoverlengretidværtinteressertifysisktreningi forholdtilfotball.jegharikkehattnoensærskiltkompetansepåområdet,menerselv innesominstruktøriettoppidrettsmiljøiolympiatoppenvestnorge.vedsidenavåvære spillerutvikleriløv HamFotballjobberjegsomspillerutviklervedToppidrettslinjei Bergen.Møtetmedinstruktørerogutøverefraflereulikeidretterharstimulert nysgjerrighetoginteressehosmeg. JegbestemtemegtidligforatjegvilleskrivemintrenerIII oppgaveinnmot fotballspesifikkfysisktrening.ettermangeforslagogideerklartejegåkommefremtilen problemstillingsompassettiltemaetjegønsketåjobbemed. Problemstilling Idenneoppgavensetterjegfokuspåhvordandettrenesfotballspesifiktfysisk. Hovedproblemstillingenerogsåutformetmedbakgrunnidettearbeidet; Hvordanbørvitrenefysiskpåenfotballspesifikkmåte? Underproblemstillingenemineeridennesammenhengenavhjelpendefaktorforatjeg harholdtfokusgjennomoppgaven; o Hvordantrenesdetgenereltfysiskpåenfotballspesifikkmåte? 3

4 o Hvordanvilulikeendringeritreningssituasjonensforutsetningerskapeendringiden fysiskepåvirkningen? Disseproblemstillingerharværtbåderetningsgivendeforoppgavensdreining,bådei forholdtilteoretiskreferanseramme,ogmetodiskdel. Teoretiskforankring Foråfinnesvarpåproblemstillingen,harjegforankretoppgavenienteoriramme omkringfysisktrening.oppgavensteoridelbyggerpålitteraturjegharfåttinnspillpåfra flereulikehold. Defysiskearbeidskraveneifotballharståttsentralt,enpresentasjonavhvaintensitetog treningii sonerer,hvaenergiomsetninghandleromogdetsammemedrestitusjonsom erenviktigdelavgenerelltreningsplanleggingogkvalitet.jegstuderteogsåen undersøkelseomkringhøyintensitetstreningifotball. Metodedel Undersøkelsensomkrystallisertesegutformeg,bleåfinneuthvordanuliketoppklubber inorgetrenerfotballspesifiktfysisk.jeghaddekontaktmedfireulikeklubbmiljøerogfikk innblikkidereshverdagogukesyklusikonkurransesesong.jeggjennomførteuformelle, kvalitativeintervjuermeddefysisketrenerneidisseklubbene.dettesammenlignetjeg medegneundersøkelserogegenukesyklusiløv HamFotball.Videregjennomførtejeg kvalitativeundersøkelseromkringhvordanendringavforutsetningerkunneendreden fysiskepåvirkningenitrening.jegvarnødttilåvelgeenmetodisktilnærmingsompåden enesidenkunnegietstørstmuligutbytteiforholdtilintensjonen,ogsomsamtidiglot seggjennomføremeddemidlerogdemulighetersomharståtttilrådighet. Altialtvurdererjegdenneundersøkelsensvaliditetsomtilfredsstillende,noejegogså finnerundersøkelsensreliabilitet. 4

5 Oppsummerendedrøfting/diskusjon Mindiskusjonomkringhvordanvikantrenebestfysiskbaserersegpådeundersøkelsene jegforetok,ogsamtidigdenteorisomharlagtibunniminoppgave.jegsåulike utfordringermedukesyklusenitoppfotballen,innslagavtreningii soneroghvordanvi kanskapeenvidereutviklingforåjobbebedrepådettefeltet.jegharværtopptattavå finnevariablerforåblibedrepååtrenebedre. Avslutningogkonklusjon Jegkonkludereridenneoppgavenmedatvi børistørregradøkevårbevissthetiøvelsesutvalget.påvirkervidetsomvi faktiskønskeråpåvirke? måværemerbevisstepåhvordancoachingepåvirkerintensitet.denkanøkes foreksempelfrai sone2tili sone4barevedenkleinstrukser. blimerbevisstepååtrenelavtnårvimeneråtrenelavt.påsammemåtei motsattfall,dersomvårintensjoneråtrenemedhøyintensitet.begynnervien øktpåfeilnivå,erdetvanskeligåkorrigereiløpetavøkten. måfåstørreinnslagavlavintensitetstreningforåbyggeetstørrevolum.med detkanvitåleåspissetreningenendamer. kanmedfordelblimerbevisstepåatbanestørrelse,ferdigheteneilaget,og antallspillerepåvirkerdenfysiskebelastningen børogsågåmeriretningav7:7og8:8istedetfor3:3og4:4.detteforågjøre intensivtspillmerfotballspesifiktogmindrebelastende. somjobberitoppklubbermåbliflinkeretilåutnyttedeteknologiske ressurseneogdenregistrerteinformasjonenvibesittter.dakanviutvikleden fysisketreningenytterligere. 5

6 Amancanseldom very,very,seldom fightawinningfight againsthistraining;theoddsaretooheavy. MarkTwain( ) 6

7 INNHOLDSFORTEGNELSE FORORD... 2 SAMMENDRAGAVOPPGAVE... 3 INNHOLDSFORTEGNELSE INNLEDNING PRESENTASJONPROBLEMSTILLING(ER) BEGREPSAVKLARING Aerobkapasitet Anaerobterskel Arbeidsøkonomi Belastningsfaktorer Energiomsetning(energiprosesser) Intensitet Intensitetssone Kvalitet Maksimaltoksygenopptak(VO 2maks ) Muskelensarbeidsmåter Overkompensasjon Supereksponering Treningsbelastning Utholdenhet Spesifisitetsprinsippet Variasjonsprinsippet Mennesketerenhelhetogreagererhelhetlig Progresjonsprinsippet Blokkprinsippet OPPGAVENSOPPBYGGING TEORIDEL INTENSITETSSONER TreningiI sone TreningiI sone TreningiI sone TreningiI sone TreningiI sone TreningiI sonene6,7og FYSISKEARBEIDSKRAVIFOTBALL ENERGIOMSETNING RESTITUSJON Restitusjonstiltak FRASTUDIEN HIGH INTENSITYTRAININGINFOOTBALLPLAYERS METODEOGGJENNOMFØRING METODOLOGIENSDESIGNOGUTFORMING Kvalitativtogkvantitativt Kvalitativeintervjuer

8 3.1.2Kvalitativeundersøkelser VURDERINGAVUNDERSØKELSENSKVALITET METODOLOGISKESVAKHETER UNDERSØKELSESRESULTATER PRESENTASJONAVINTERVJUER PRESENTASJONAVUNDERSØKELSER DRØFTINGSDEL AVSLUTNINGOGKONKLUSJON...53 ETTERORD REFLEKSJONOVEREGETARBEID LITTERATURLISTE

9 BildetillustrererHFbelastningiløpetavenkamp 1.0 INNLEDNING Idenneoppgavenharjegvalgtåskriveomfysisktrening.Deterfleregrunnertildette. Hovedgrunneneratjegsynesdetteerdetfagområdederjegharlavestkompetanse.Jeg haralltidsettpåmegselvsomennnysgjerrigogvitebegjærligtrener.jegharreistog besøktklubberinorge,frankrike,italia,england,belgiaforåstyrkekompetansen.men jegharalltidfordypetmegidetjegharværtmestinteressertiogmestopptattav.jeg haralltidværtmestopptattavreneogrelasjonellefotballferdigheteride25årenejeghar værtfotballtrener.desisteåreneharjegjobbetsomspillerutviklerpåheltidpå ToppidrettsgymnasetiÅsaneogiLøv HamFotballiBergen.Derjobberjegmedunge spilleresomnærmestovernattengårfrafemtiltolvukentligetreningsøkter.fysisk treningerensærdelesviktigdelavdethelhetligetreningsoppleggetforslikespillere.feil påvirkningidennefasenavenspillerskarriere,kanværefullstendigødeleggende.derfor harjegbestemtmegforåstyrkekompetansenminpådettefeltet. Enannengrunntilatjegvilgjøredettegrundig,eratjegharopplevdmangelpå konsensusifotball ogtoppidrettsmiljøet.detfinnesfagmiljøerogautoriteterpådette 9

10 områdetsomstårsteiltmothverandre.somlitefagligutrustet,harjegikkehattnoen somhelstselvstendigvurderingsevneavdeulikeoppfatningene. Jegharmåttetsynse,sitere,imitereellerstoleblindtpåandre tildelsmotsetningsfylte læringskilder. Jegharikketattmålavmegåfinnedenfulleogenestefasiten,menjegønskeråtrenge innimaterialetogdannemegminedokumenterbareoppfatningeromhvordanenbest muligbørtilretteleggedenfysisketreningenforåoppnåutvikling.jegharønsketåbli merbevisstpåsammenhengmellommålogmidler,ogharatdetteskalværebasertpå vitenskap. Jegsynesogsådetharværtmotiverendeåkunnesettedenfysisketreningeninnen toppfotballeninnietstørreperspektiv,foråbedrekunnetastillingtilhvasomermyter oghvasomersannheteromfotballsomtoppidrett. Etsistemomentsomharmotivertmegtilåtafattpådenneoppgaven,erenpåfallende likformutviklingilagetjegharværtmedåtrenedesistefireårene Løv HamFotball.De sistefireåreneharlagetvårttattpåfallendefærrepoengomhøstenenniløpetav vårsesongen.jegtrorikkedetteertilfeldig,ogharlysttilåforbedredenfysiske treningenvårforatdetteikkeskalskjeifortsettelsen. 1.2 Presentasjonproblemstilling(er) Hovedproblemstillingenidenneoppgavener: Hvordanbørvitrenefysiskpåenfotballspesifikkmåte? Denneproblemstillingenerbreiogfavneroversværtmye.Jegharværtbevisstpådette ogsettfarenveddet.mensomjegbeskriverinnledningsvisharjeghattetønskeomå læremestmuliginnenforetproblemfeltjegikkeharhattnokkunnskappå.noen 10

11 underproblemstillingererlikefulltsentraleformeg,ogværtennaturligdelavdetåfinne svarpåhovedproblemstillingen: o Hvordantrenesdetgenereltfysiskpåenfotballspesifikkmåte? o Hvordanvilulikeendringeritreningssituasjonensforutsetningerskapeendringiden fysiskepåvirkningen? 1.4 Begrepsavklaring Heravklaresendelsentralebegrepersomblirnyttetidennebesvarelsen Aerobkapasitet Aerobkapasiteterdentotaleaerobeenergiomsetningen(oksygenopptaket)iløpetaven definerttidsperiode.denkanogsåoppgissomgjennomsnittligoksygenopptakiløpetav dendefinertetidsperioden Anaerobterskel Anaerobterskelerdenhøyesteintensiteten(meterpersekund,watt)ienbestemt aktivitetsformderutøverharlikevektmellomproduksjonogeliminasjonavlaktat Arbeidsøkonomi Arbeidsøkonomieretmålpåhvormyeenergienutøverforbrukervedenbestemtfart ellerenbestemttilbakelagtdistanse.arbeidsøkonomienvedaerobtarbeider oksygenopptaketvedenbestemtfartelleroksygenopptaketprdistanseellerveden bestemttilbakelagtdistanse.teknikkerenviktigfaktorforarbeidsøkonomien Belastningsfaktorer Belastningsfaktoreneerintensitet,varighet,metode,aktivitetsform,underlag,sprint, antallsprintogpauselengde,værforholdoggeografiskeforhold Energiomsetning(energiprosesser) Prosesserimuskelfibrenesomomsetterenergi: 11

12 Kreatinfosfatprosessen(alaktasid) Anaerobomsetningavkarbohydrater(laktasid) Aerobomsetningavkarbohydrater Aerobomsetningavfett Intensitet Intensitetenerknyttettildenfysiskeinnsatsenienøvelse,aktivitetellerkamp. Hjertefrekvens oglaktatmålingergiretobjektivtbildeavdenindreintensiteten.farter etobjektivmålfordenytreintensiteten Intensitetssone Treningendelesinni8intensitetssoner.Inndelingenerforetattpåbakgrunnavhvordan ATP(energi)gjenoppbygges,oghvasomerhensiktenmedtreningsøkten Kvalitet Kvalitetinnebærerattreningengjennomføresetterhensikten.Begrepeterikkeidentisk medintensitet! Maksimaltoksygenopptak(VO 2maks ) VO 2maks erdenstørstemengdenoksygenkroppenkantaoppperminutt.detmaksimale O 2 opptaketuttrykkesiliterperminutt,milliliterperkilogramkroppsvektperminutteller medenfaktorforkroppsvektsomsamsvarerbedremedprestasjonen(milliliterper kilogramkroppsvektperminuttellermillimeterperkilogramkroppsvektperkilometer). OlympiatoppendefinererVO 2maks somgjennomsnittetavdehøyestevo 2 målingeneover ettminutt.detkanværestoreforskjellerivo 2maks forsammeutøveriulike aktivitetsformer,ogderforskalaktivitetsformenoppgissammenmedvo 2maks Muskelensarbeidsmåter Enmuskelkan Forkortes(konsentriskmuskelaktivitet) Strekkes(eksentriskmuskelaktivitet) 12

13 Arbeidesomenfjær(kombinasjonaveksentriskogkonsentrisk,dvsplyometrisk muskelaktivitet) Holde(isometriskmuskelaktivitet) Overkompensasjon Overkompensasjoneretresultataventreningsbelastningmedetterfølgendegod restitusjon,somførertilethøyereprestasjonsnivåennutgangspunktet Supereksponering Supereksponeringerenekstrastortreningsbelastningienøkt,dag,uke,enhelellerdeler aventreningsperiode.supereksponeringførertilenplanlagtoverbelastningavkroppen. Denmåetterfølgesavenlangnokrestitusjonsfase,oggirdaensuperkompensasjon Treningsbelastning Treningsbelastningenersummenavallebelastningsfaktorersompåvirkerspillerenunder entreningsøkt.treningsvarighet(treningstid)ogtreningsintensiteterdetoviktigste belastingsfaktorer Utholdenhet Utholdenhet(aeroboganaerob)erkroppensevnetilåmotståtretthet.Denaerobe utholdenhetharbetydningforresultatetialleidrettskonkurransersomvarerlengreenn 1 2minutter Spesifisitetsprinsippet Ispesifikktreningerbelastningsfaktoreneintensitet,varighet,aktivitetsform,underlag ogutstyrsålikforholdeneienkonkurransesommulig.hvorstordelavtreningensom børværespesifikk,varierermedkraveneidenaktuelleidretten,utøverenskapasitetog tidspunktetisesongen. 13

14 Etmålmeddenlangsiktigetreningeneratutøverenskalkunnetrenemer(fleretimer ellerlengredistanse)ikonkurranseteknikkenog intensiteten.ogsåiløpetavensesong viltreningengradvisblimerspesifikk Variasjonsprinsippet Variasjonenitreningsprosessenerviktigbådeavfysiskeogmentaleårsaker.Variert treningermerutfordreneogmindrekjedelig.variasjonenmotvirkerensidige belastningerogerdermedskadeforebyggende.detforhindrerstagnasjon,fordikroppen etterentidhartilpassetsegbelastningen.foråoptimalisereenårssykluserdetviktigå varieretreningsintensiteten,treningsvarighetenogaktivitetsformeneplanmessig. Variasjoneniorganiseringenavtreningenkanogsåøketrivselen. Prinsippetomindividuelloghelhetligstimulering Prinsippetomindividuelloghelhetligstimuleringinnebærerattreningenmåtilpassesdet enkelteindivid,samtidigsomdenutviklerhelemennesket Mennesketerenhelhetogreagererhelhetlig Selvomviiteorienforetarenoppdelingavutøverensferdigheterogegenskaper,måvi haklartforossathelhetenalltidermerennsummenavdelene.utøverenmåstimuleres helhetlig.derforbørfysiskeegenskaper,mentaleegenskaperogtekniskeferdigheter trenesparallelt,bådeihverenkelttreningsøktogoverenlengretidsperiode. Treningenmåtilpasseshvertenkeltindivid Deterstoreindividuelleforskjellernårdetgjelderhvormyetreningutøveretåler.Forat alleskalfåenoptimalprestasjonsutvikling,måtreningentilpasseshvertenkeltindivid,på bakgrunnavhvordanutøverenrespondererpåuliketypertrening.forskjelleri reaksjonsmønstrenekanskyldesarveligefaktorer,ellerdetkanværeavhengigav treningsbakgrunnen.derforkandensammetreningenhaforskjelligvirkningpåulike utøvere.detergrunnentilatalletreningsplanermåtilpassesindividuelt.enforutsening fordeteratplanenbyggerpåutøverenskapasitetsanalyseogtidligeregjennomført 14

15 trening.deterførstogfremsttreningsintensitetenogtreningsvarighetensomheletiden måtilpassesindividuelt Progresjonsprinsippet Progresjonsprinsippetinnebærerengradvisogsystematiskøkningavdeviktigste belastningsfaktoreneitreningen.belastningsskaderskyldesofteforstorprogresjon(for mye,forraskt,forofte).engradvisøkningavdentotaletreningsbelastningenog systematiskvariasjonavbelastningsfaktorene,forebyggerskaderogsykdom.deter viktigåfølgeprogresjonsprinsippetistartenavettreningsår,ogettersykdomog skadeperioder.idisseperiodeneerutøverneoftesværttreningsivrige. Treningsmotivasjonenmåaltsådempes,slikatøkningenitreningsbelastningenikkeskjer forraskt. Enfornuftigtreningsprogresjongjelderikkebarefortreningsvarighetog treningsintensitet,menogsåforandrebelastningsfaktorer.ifotballerdetviktigmed skotøyogskifteavunderlag.engradvisbelastningsøkningerogsåenforutsetningforå forbedreprestasjonsevnenkontinuerlig.progresjonenitreningenmåskjeiløpetav sesongenogfraårtilårnårdetgjelder Dentotaletreningsbelastningen Treningsintensiteten Treningsvarigheten Treningshyppigheten Aktivitetsformen Underlaget Erfaringenviseratnårtreningsbelastningenskaløke,erdethensiktsmessigåøkeantall treningsøkterførst,deretterøkevarighetenavtreningsøkteneogsåtilsluttøke varighetenpåtreningensomgjennomføresii sonene3,4og5.etterhvertkandetogså væreaktueltåerstattenoenavøkteneii sonene3eller4medøkterii sonene4eller5. 15

16 Blokkprinsippet Blokkprinsippetinnebæreratulikeformerfortreningvektleggesuliktideforskjellige treningsperiodeneienårssyklus.bakgrunnenformodelleneratforskningogerfaringhar vistatmyestyrketreningharennegativinnvirkningpåteknikkoghurtighetstreningennår beggetreningsformenebrukesisammetidsperiode(werchoshanski1988).samtiderdet myesomtyderpåatstyrketreningenblirmereffektivdersomdengjennomføresi blokker. Itilleggvisererfaringatdetikkeermuligåtreneallefysiskeegenskaperpåsammetid. Derformåtreningentilretteleggesslikatnoenutvalgteegenskaperutviklesiendefinert tidsperiode,mensandreegenskaperbarevedlikeholdes.detgjelderikkebareforholdet mellomstyrketreningogutholdenhetstrening,menogsåforulikeegenskaperi utholdenhetstreningen. Figur1 Ipraksiskanblokkprinsippetgjennomføresvedådelesesongeninnitreningsperioder medunderperioder,dernoenutvalgteegenskaperutvikles,mensandrebare vedlikeholdes.inndelingenmåplanleggessystematiskforåoppnåenoptimal 16

17 prestasjonsutvikling.varighetenavdeulikeblokkenekanvarigerefra1til12uker. Hensiktenbestemmervarighetenpåtreningsperioden. 1.5 Oppgavensoppbygging Kapittel1erviettilinnledningogbeskrivelseavoppgaven.Såfortsetterjegmedå Skriftlig oppgave presentereendelteoretiskgrunnlagsstoffmedhenblikkpåfysisktrening(kapittel2),før jegvierkapittel3tilåbeskrivemetodologienioppgaven,samtatjegviderepresenterer resultatenefraforskningsarbeidetikapittel4.metodologiogresultaterdrøftesikapittel 5oppmotoppgavensteori.Konklusjonerfattesikapittel TEORIDEL Idetfølgendepresenteresrelevantteoriomkringemnetfysisktreningogfotball. 2.1 Intensitetssoner Treningsbelastningeretsamlebegrepfordenpåvirkningenkroppenutsettesfori treningsarbeidet.denmåtilpassesutøverenståleevne.samsvaretmellom treningsbelastningogtåleevnebestemmerhvorrasktoghvormyeprestasjonsevnen forbedres. Utformingenavtreningsøktenmåtautgangspunktihensiktenmedtreningen.Deter sammensetningenavbelastningsfaktorenesomavgjørtypenogstørrelsenpå treningsbelastningen.ifotballertreningsintensiteten,treningsvarigheten, aktivitetsformen,lengdenpåtreningenogpauserdeviktigstebelastningsfaktorene. 17

18 Figur2 Foratviskalkunneplanlegge,gjennomføre,dokumentereoganalysere utholdenhetstrening,mådendelesinniintensitetssoner.olympiatoppenhar,isamarbeid medfagpersonellfranorgesidrettshøgskole,definert8intensitetssoner.inndelingener foretattpåbakgrunnavhvordanatpgjennombyggesoghvasomerhovedhensikten medtreningsøkten.tabell(under)girenoversiktoverolympiatoppensåttedelte intensitetsskala,medveiledendeverdierfor%avvo 2maks, maksimalhjertefrekvens(hf maks),laktatverdierogeffektivvarighetforhverenkeltintensitetssone. Feedbackfrahjertefrekvens(pulsbelte) oglaktatmålingerundertreningogtesting forbedrerutøverensintensitetsfølelse.dissemålingeneerderforviktigehjelpemidlerfor åstyretreningenslikatdenblirgjennomførtsomplanlagt. 18

19 OlympiatoppensI soneinndeling Fig3 I-sone 8 I-sone 7 I-sone 6 I-sone 5 I-sone 4 I-sone 3 I-sone 2 I-sone 1 % av VO2 % av H Laktat(Lactate Effektiv maks maks Pro) varighet min min min ,0-10, min ,0-6, min ,5-4, min ,5-2,5 1-3 timer ,8-1,5 1-6 timer TreningiI sonene1 5påvirkerihovedsakdeaerobeenergiprosessene.Treningi intensitetssonene6,7og8påvirkerhovedsakeligdeanaerobeenergiprosessene. Hensiktenmeddenaerobeutholdenhetstreningeneråutvikledenaerobekapasitetenog arbeidsøkonomien.detskjergjennomenforbedringavkapasitetenihveravde5aerobe intensitetssonene.kapasitetenkanforbedresvedatutøverenkan Holdehøyerefartvedsammepuls Arbeidelengermedsammepuls TreningiI sone1 HovedmåletmedtreningiI sone1eråforbedredenaerobekapasitetenog arbeidsøkonomien.vedtreningii sone1forbedresaerobkapasitethovedsakeligvedat utnyttelsesgradenblirbedresomfølgeavatdelokaleforholdeneiogrundt muskelfibreneforbedres.iintensitetssone1erdetaerobenergiomsetning,medca %omsetningavfettogca.60 40%omsetningavkarbohydrater.Deterbalansemellom tilførselogbehovforoksygenienergiomsetningen.dermederdetlikevektmellom produksjonogeliminasjonavlaktat(laktatlikevekt). 19

20 Treningstideniintensitetssone1erlang(éntiltotimer).TreningiI sone1omfatterogså restitusjonstrening.denharsomhensiktågjenopprettehomeostasenogbyggeopp karbohydratlagreneetterkamp.davilutøverpresterebedreinesteøkt.i restitusjonstreningvarierertreningstidenideflestetilfellermellom45og60minutter,og treningengjennomføressomkontinuerligarbeid TreningiI sone2 HovedmåletiI sone2eråforbedredenaerobekapasitetenogarbeidsøkonomien.ved treningii sone2forbedreskapasitetenhovedsakeligvedatutnyttelsesgradenblirbedre somfølgeavforbedretevnetilfettomsetning. Iintensitetssone2erdetaerobenergiomsetning,medca.50 80%karbohydraterogca %omsetningavfett.Deterbalansemellomtilgangogforbrukavoksygeni energiomsetningen.dermederdetlaktatlikevekt.treningii sone2kanderforhalang varighetførkarbohydratlagreneblirtømt.treningstideneiintensitetssone2børvære lang(éntiltotimer) TreningiI sone3 HovedmåletmedtreningiI sone3eråutvikledenaerobekapasitetengjennomen forbedringavutnyttelsesgraden,arbeidsøkonomienogvo 2maks. Detgirsegutslagi forbedretfartveddenanaerobeterskelen,altsåen høyreforskyvningavlaktatprofilen. Bedreaerobkapasitetogbedrearbeidsøkonomiforbedrerevnentilåarbeidelengreved denanaerobeterskelen.iintensitetssone3erdetaerobenergiomsetning,med80 90% omsetningavkarbohydraterog10 20%omsetningavfett.Deterbalansemellomtilgang ogforbrukavoksygenienergiomsetningen,altsåerdetfortsattlaktatlikevekt. Treningsøkteriintensitetssone3børgjennomføresmedspesifikkaktivitetsformogen 20

21 effektivvarighetpå40til60minutter.dersomhensiktenmedåvedlikeholdekapasiteten ii sone3kaneffektivvarighetreduserestil25 30minutter TreningiI sone4 HovedmåletmedtreningiI sone4eråutvikledenaerobekapasitetengjennomen forbedringavutnyttelsesgraden,arbeidsøkonomienogvo 2maks. Detgirsegutslagi forbedretfartveddenanaerobeterskelen,altsåen høyreforskyvningavlaktatprofilen. Iintensitetssone4erdetfortsattoverveiendeaerobenergiomsetning,med80 95% omsetningavkarbohydraterogca.5 10%omsetningavfett.Ca5 15%av energiomsetningenkommerfraanaerobelaktatsideprosesser,somomsetterrelativt storemengderkarbohydrater.denytreintensiteten(farten)ersåhøyatproduksjonenav laktaterstørreenneliminasjonen.vedkontinuerligebelastningervildetderforgradvis hopesegopplaktat.treningsøkteneiintensitetssone4hareneffektivvarighetpå25til 40minutter.DersomhensikteneråvedlikeholdekapasiteteniI sone4kaneffektiv varighetpåtreningsøktenreduserestil15 20minutter TreningiI sone5 HovedmåletmedtreningiI sone5eråutvikledenaerobekapasiteten.treningenvilogså tilenvissgradpåvirkedenanaerobekapasiteten(toleranseevnen). TreningiI sone5innebærerenintensitetpåellerlikeiunderkantavdetmaksimale oksygenopptaket.intensitetenertydeligoverdenanaerobeterskelen.derformå10 25% avenergienkommefraanaeroblaktsidenergiomsetning.varighetenpåøktenii sone5 erderforrelativkort.75til90%avenergienkommerfraaerobomsetningav karbohydrater.treningii sone5børnestenutenunntakgjennomføreskamplikt.den effektivevarighetenervanligvis15 25minutter,ogøktengjennomføressom intervallarbeidhvorpauseneerlittkortereennarbeidstid. 21

22 2.1.6 TreningiI sonene6,7og8 HovedmåletmediI sonene6,7og8eråutvikledenanaerobekapasitetenvedå forbedreevnentilåprodusereatppertidsenhetvedhjelpavdetanaerobelaktaside systemet.treningenvilogsåøketoleransenformelkesyre. Disse3soneneharliterelevansmedfotball. Innenforfotballensegenartvariererintensitetenmyeiløpetavenkamp.Derforvelger manengrovereinndelingavintensitetssonene.inndelingenerlav,moderat,sværthøy (setabellunder) Intensitetssoner brukt i fotball Figur4 Detviktigsteerattreningsprogrammeterøktermedforskjelligeintensiteter,ogat varigheteneravpassettilintensiteten.forengodttrentfotballspillerbørvarighetenpå innsatsenvedlavintensitetvære40 60minutter,vedmoderatintensitet20 40minutter, vedhøyintensitet10 20minutterogvedsværthøyintensitet2 5minutter (hurtighetstrening). 2.2 Fysiskearbeidskravifotball Fotballerensammensattidrett,somstillerkravtilmangeulikefaktorersomjogging, hopping,spurtingiminst90minutter.fotballspillerenmåværeallsidig,menifotballer detogsåmuligåkompensereforsvakheterpåettområdeogholdehøytnivåpåandre 22

23 områder.forskningharprøvdådefineredefysiskeutfordringersomfinnesifotball. Imidlertidvilfotballspilletskompleksitetgjøredetvanskeligådefinereandreabsolutte krav. Figur5 Etlagssamledefotballferdigheterersummenavdeenkeltespillernesfotballferdigheter ogitilleggtillagetsevnetilsamhandling.defysiskeressurseneskalgjørespillerenistand tilåutnyttefotballferdighetenesineikampsituasjonenoggjørelagetistandtilå gjennomføredettaktiskeoppleggetogderetningslinjeneforspilletmanerblittenigom. Påsammemåtemåspillerentahensyntilsinefysiskeressursernårhanellerhunskal utformeoggjennomførefotballferdighetenesine.nårmanskaltreneoppdefysiske ressursenemåmantautgangspunktifotballspilletogresultatetavtreningenmå bedømmesoppmothvilkeneffektdenharpåspillet. Enutespillertilbakeleggermellom8 13kmiløpetavenfotballkampogdeterliten variasjonbådemellomkjønnogmellomdeulikenivåene(disalvo2007,krustrup2005). Tilbakelagtdistanseerlikeveletgrovtmålpådefysiskekraveneunderenfotballkamp. 23

24 Deterfordimestepartenavforflyttingenskjervedgangeogjoggingmedlavintensitet. Over90%avtidenienfotballkampbenyttestilåstå,gåellerroligløping(setabell under).dentilbakelagtedistansenvariererogsåavhvilkenposisjonspillerenharpålaget. Midtbanespillereløperenlengredistanseennspillereiandreposisjoner,mens midtstoppereløpermindreennandre(disalvo2007,mohr2003).backer,kantspillereog angrepspilleresprintermerennmidtstoppereogmidtbanespillere(disalvo2007). Tidsbrukikampfordeltpåulikeintensiteter Verdieneergittiprosentavtotalkamptidogoppgissomgjennomsnitt(standardavvik)for mennoggjennomsnitt(variasjonsbredde)forkvinner.høyintensivløpinger>20km/time forkvinnerog>24km/timeformenn.internasjonaltnivåerlagsomspillereuropa cup, nasjonaltnivåertypisk2.divisjon.setabell1.2,fotnotefordefinisjonavsprint. Figur6 Detinteressanteeratbare1 2,5%avdentilbakelagtedistansengjøresmedball(DiSalvo 2007).Igjennomsnittgjørspillerneenaktivitetsendringhvertfjerdesekund,somtilsvarer nesten1500aktivitetsendringeriløpetavenkamp(krustrup2005).spillerepå internasjonaltnivå(toppklubberieuropa)løperaltsåikkenødvendigvisenlengre distanseennspillerepånasjonaltnivå,menandelensprinterbetydelighøyerehos spillerepåinternasjonaltnivå.ienundersøkelsefantmanatinternasjonaletoppspillere dekker28%størredistansehøyintensivløping(>24km/t)og58%størredistanseved sprining(>30km/t)ennspillerepålaverenivå.detskyldesførstogfremstatdegjørflere høyintensiveløpogikkeatdeløperlengrepr.løp(setabellunder).deterinteressantå merkesegatkvinnerpåinternasjonaltnivågjennomførerlikemangesprintersommenn pånasjonaltnivå(denhastighetensomerdefinertsomsprint,erforkvinner25km/tog formenn30km/t.fratalleneovenforkanviregneutatforhverthøyintensiveløppå2 4 sekunderergjennomsnittet20 40sekundermedroligaktivitet(stå,gåellerjogge). Mellomhvergangenfotballspillersprinter,erdetigjennomsnittover2minutterpå 24

25 internasjonaltnivåogover3minutterpånasjonaltnivå.studierharogsåvistatantall sprintereretsuksesskriteriumifotball.dentilbakelagtedistansenermindreiandre omgangenniførste,bådenårdetgjelderlavintensitetsløping,høyintensivløpingog sprinting(disalvo2007,mohr2003). Antallhøyintensiveløp,sprinter,taklingerogheadingeriløpetavenkamp Verdieneergjennomsnitt(standardavvik)formennoggjennomsnitt(variasjonsbredde)for kvinner.sprinter>25km/timeforkvinnerog>30km/timeformenn. Figur7 Figur8 25

26 FigurenovererfraNM4.runde2009mellomRosenborgogLøv HamFotball.Somman seravfigurenerdetmarginaleforskjelleriløpslengdenforrbkogløv Ham.Imidlertid hadderbk17%merhøyhastighet+sprint,mensforskjellenøkteendameriforholdtil sprinthvorrbkhadde38%merennløv Ham.Dettegjenspeilerteorien. 2.3 Energiomsetning Foråutføreetarbeidkrevesdetenergi.Energienkommerfrakarbohydrater,fettog proteinersomvitilførerkroppenframatogdrikke.ikroppenbyggesdetopplagreav fettogkarbohydrater.foratenergienimatenskalkunnebenyttesi muskelkontraksjoner,mådenomsettestilatp(adenosintrifosfat).detmesteav energiensomomsettes,kommerfrakarbohydraterogfett.karbohydratenesomdet finnesmestavikroppen,erglykogenogglukose.jegbrukerbetegnelsenkarbohydratog karbohydratlager.fettfinnessomfettsyrerogtriglyseridermenjegbrukerbare betegnelsenfett. Prosessenesomomsetterkjemiskenergi(fett,karbohydraterognoeprotein)tilATP kallesaeroboganaerobenergiomsetning.aerobenergiomsetningbenytterogså oksygen,mensanaerobenergiomsetningeruavhengigavoksygen. Energikanikkeoppståellerforsvinne.Derforbrukesbegrepetenergiomsetningogikke energiproduksjonomdenneprosessen.energiomsetningenersentralfor prestasjonsevnenogtreningsprosessen. Påsammemåtesomenbilmotorkanomsettedenkjemiskeenergienibensintilåskape drivkrafttilbilhjulene,kankroppenomsettedenkjemiskeenergienimatentilmekanisk arbeid(musklenebevegerknokleneslikatetarbeidblirutført).foratdenkjemiske energiensomfinnesikarbohydrater,fettogproteiner,skalkunnebenyttestilmekanisk arbeid,mådenkjemiskeenergienførstomsettestilatp. 26

27 Bare25%avenergieninæringsstoffenegårovertilmekaniskarbeid.Restenbliromsatttil varme.muskelfibrenesomskalutførearbeidet,brukerenergiensomfinnesiatp.veden muskelkontraksjonomsettesatptiladp(adenosindifosfat). ATP >ADP+P(fosfat)+energi DetfinnesbareenlitenmengdeATPimuskelfibrene,noktilnoenfåsekundersarbeid. ForåunngåatATPinnholdetfallerunderenvissgrensenårmuskelenskalskapekraft lengerenninoenfåsekunder,måadpmolekyletbyggesopptilatpigjen.denne gjenoppbyggingenkreverenergi.energiensomtrengsfårådannenyatpskaffer musklenesegvedåomsettekarbohydraterogfettellervedåoverføreenergienfra kreatinfosfat. ATPgjenoppbyggesvedhjelpav4prosesser.Påfigurenunderskalde4beholderne illustreredisseprosessene.ettersombidragetfraproteinienergiomsetningenerlite,er proteinutelattimodellen. Figur9 De4prosesseneforenergiomsetninger 27

28 Kreatinfosfatprosessen(alaktasid)(beholder1) Anaerobomsetningavkarbohydrater(laktasid)(beholder2) Aerobomsetningavkarbohydrater(beholder3) Aerobomsetningavfett(beholder4) Kreatinfosfatprosessen(beholder1)oganaerobomsetningavkarbohydrat(beholder2) skjerutenbrukavoksygen,ogprosesseneerforanaerobe.aerobomsetningav karbohydrater(beholder3)ogaerobomsetningavfett(beholder4)skjermedoksygen ogprosesseneerderforaerobe.energilagreneogenergimengdensomkanomsetteside 4prosesseneeravforskjelligstørrelse.Detersymbolisertvedulikestørrelserpåde4 beholderne.mengdenatpsomkanomsettesprtidsenhetsymboliseresveddiameterpå røreneutfrade4beholderne. Prosesseneforenergiomsetningarbeidersammenforåleveredennødvendige energimengdensombrukestilåbyggeoppigjenadptilatp.hvilkenprosesssomleverer mestenergiistorgradavhengigavarbeidetsintensitetogvarighet(sefigurunder),og hvilkemuskelfibertypersomeribruk.ogsåutøverensprestasjonsevne,størrelsenpå karbohydratlagrene,hvasomblespistognårinntaketavnæringskjedde,kanpåvirke hvilkenprosesssomgirmestenergi. Hvorlangtiddettarførkarbohydratlagreneertomme,erførstogfremstavhengigav intensitetenogvarighetenpåarbeidet,ogavstørrelsenpåkarbohydratlagrene.dessuten vilevnentiløktomsetningavfettutsettetømmingenavkarbohydratlagrene.vedtrening ii sone3(80 87%avVO 2maks )kommerca.80 90%avenergienfrakarbohydrater(se figurene1.7og1.8).engodttrentfotballspillerkantreneii sone3ica.90minutterfør karbohydratlagreneertilnærmettomme(figur1.6).treneii sone4(ca.87 94%av VO 2maks )viltømmekarbohydratlagreneetterca.60minutter.karbohydratlagrenevarer lengrejobedretrentmaner.detskyldesatdeharstørrekarbohydratlagre,ogatde forbrukermindrekarbohydratermenmerfettenndårligtrentepersonervedsamme intensitet.jobedretrentmanerjolengrekanmanøkevarighetenihverintensitetssone. 28

29 Deterviktigåfølgeoppkarbohydratlagreneettertreningvedåspisekarbohydrater.Det tar12 24timeråfølgeopptommekarbohydratlagre,avhengigavtypenæringog treningstilstand.sportsdrikkellerlettfordøyeligmatmedhøytkarbohydratinnholdbør inntasalleredeundernedjoggingellergjerneunderveisiaktiviteten,dersomdetermulig. Deterviktigattilførselenav1 1,5gramkarbohydraterperkilogramkroppsvektskjerraskt oghelstinnen30minutteretteravsluttetaktivitet.etterenhøyintensitetsøkterdet viktigåinnta10 20gramproteinitilleggtilkarbohydratene.Proteinstimulererbåde proteinsyntesenoglagringenavkarbohydrat. Dersomutøverenikkespisernokkarbohydraterundermåltidenemellomtreningsøktene, kandetovertidføretilkronisklavtkarbohydratnivå.deterikkemuligågjennomføre treningiintensitetssone3ellerhøyerepåenoptimalmåte.årsakeneratutøverengår tomforkarbohydratertidligiøkten,ogintensitetenmåreduseres,ellertreningsøktenmå avsluttes. Riktiginntakavnæringerderforenavgjørendefaktorforåkunnegjennomføretrening medhøyintensitet(intensitetssonene3 7). Treningsomsystematisktømmerkarbohydratlagrene,ogsystematiskoppfyllingmellom økteneføreretilatlagrenesstørrelseøker.detteerenviktigtreningseffekt. 2.4 Restitusjon Lengdenpårestitusjonstidenavgjørhvormyeoghvorofteutøverenkantrene.Deneri hovedsakavhengigavtreningsbelastningen,hvaslagsrestitusjonstiltakutøveren benytterfør,underogettertreningsøkten,ogutøverenstreningstilstand.ifølgebadtke (1987)restituererinternasjonaleutøveresegdobbeltsårasktsomutøveremeddårlig treningsgrunnlag.iaerobutholdenhetstreningoptimaliseresrestitusjonenved tilstrekkeligpåfyllavveskeognæring(brukeogdeeakin2000).erfaringviseratgod generellaerobkapasitetredusererrestitusjonstidenforalleidrettsutøvere. 29

30 Restitusjonstidenkanværeforskjelligfrautøvertilutøver,uavhengigav prestasjonsnivået.itileggpåvirkesrestitusjonstidenavhvilkefysiskeegenskaperog strukturersombelastes.dettarselvsagtkorteretidågjenoppretteveskebalansenenn ogbyggeoppkarbohydratlagene.dermedkannoenstrukturerværefullstendig restituert,mensandredelvisrestituert.denpraktiskeerfaringenmed2og3 treningsøkterperdag,viseratdetermuligogtreneførutøverenerfullstendigrestituert. VedogtreneiI sone1og/ellervariereaktivitetsformeneerdetmuligåstarteny treningsøktlengeførrestitusjonenerferdigfullstendig Restitusjonstiltak Foråkunnetrenemedstørrevarighetoghøyereintensitetmåmansetteinntiltaksom forkorterrestitusjonstiden.restitusjonstiltakenepåvirkerfysiologiske,psykologiskeog sosialefaktorer.restitusjonsmetodenemåvarierebådefør,underogetter treningsøkten,ogdeeristorgradavhengigavtreningensomergjennomført.for eksempelkannoentiltakværebedreegnetetterstyrketreningennetter utholdenhetstrening.nedenforbeskrivesnoensliketiltak.denmentaleogsosialesiden erselvsagtogsåviktigmenjeggårikkeinnpådether. Sørgforåhafullekarbohydratlagreførtreningogkamp Foråkunnepresteregodtikamperdetviktigoghavelfyltekarbohydratlagre.Deter ogsåenforutsetningforåkunneopprettholdeintensitetenlengenokii sone3 6.det sistemåltideførentreningsøktellerenkampmåtilførekroppenrikeligmed karbohydrater.tidspunktetforoginnholdeisistemåltidmåselvsagttilpasses totalbelastningen,ogdeindividuellebehov.måltidetbørinneholderikeligmedvann, melkfruktjuiceellersaftgenereltbørdetsistemåltidetinntas2 3timerføroppvarmingen starter.detsikreratblodsukkernivåetnormaliserersegførstart,ogdetforhindrer mageproblemerundertreningellerkamp.måltidetbørinneholdeca,55 60prosent energifrakarbohydrater,ca30energiprosentfraproteinerogca15energiprosentfra fett.vedlangetreningsøkterellerkamperkandetværehensiktsmessigåinntalitt karbohydrater foreksempelloff,bananellerenergibarca1timefrastart.itileggtil 30

31 næringsinntaketvilogsåhvile,lettfysiskaktivitetogmassasjekortened restitusjonstiden. Undertreningogkamp Opprettholdvæskebalansen,fyllpåmedkarbohydraterogværiaktivitetipausene. Væsketapetundertreningogkampvarierervanligvismellom0,5og2,0literpertime, avhengigavtreningstilstand,treningsintensitet,påkledningogværforhold.prestasjonsevnenreduseresmedca10%forhverprosenttaptkroppsvektpågrunnav væsketap.utøverenbørderfordrikke0,4 1,0literunderalltreningsomvarerimerenn 30minutter,uavhengigavintensitetogværforhold.Dersomdetersværtvarmteller fuktig,erdetbehovforbetydeligmervæske.væskeinntaketbegynnersenest15minutter etterstart,ogopprettholdesmedca.0,2 0,3literhvert20.minutt.Kald,drikke,menikke iskald,ervelegnetivarmtklima.ikaldtklimaerdetmerbehageligåbrukevarmere drikke.enutøverdrikkersannsynligvismerdersomdrikkenervelsmakende.utøverenmå selvfinneframtilriktigkonsentrasjonogtemperatur. Vanligvistrengerikkeutøverenåinntakarbohydraterdersomtreningeneller konkurransenerkortereenn60minutter.dersomkarbohydratlagreneikkeerfullenår aktivitetenstarter,kankarbohydratinntakfremmeprestasjonsevnenselvvedenslikkort belastningstid.redusertekarbonhydratlagreskyldessomregelforlavt karbohydratinntakgenerelt,ikombinasjonmedstortreningsbelastning.ved treningsøkterogkonkurranserover60minutterbørkarbohydratinntaketvære30 60 gramhvertime.dettilsvarerkarbonhydratinnholdetica5 10dlsportsdrikk. Karbohydratholdigdrikkeerbådepraktiskogenkeltoginnta,samtidigsomrisikoenfor mageproblemererliten.utøverenbørinntakarbohydrateralleredeiløpetavdeførste 30minutteneforatdetskalhaprestasjonsfremmedeeffekt,ogfortsettemeddethvert 15 20minutt.Eventuellepausermellomintervalldragellerkonkurranserbenyttestillett aktivitetoginntakavkarbohydraterogvæske. 31

32 Ettertreningogkonkurranser:spisogdrikkumiddelbart! Kostholdetharstorbetydningforrestitusjonsprosessene.Grunnentilattopp idrettsutøvereinntardrikkerettettermålpassering,eratdetsetterigang restitusjonsprosessenehurtig.slikerestitusjonsdrikkerinneholderrikeligmed karbohydrater,menogsåendelproteiner.dersomutøverenslurvermedinntakav restitusjonsdrikke,kanblantannetimmunforsvaretsvekkes,ogrisikoenforfeiltrening øker. Foråmålevæsketapetundertreningkanutøverenveiesegførogettertreningsøkten. Detgirenpekepinnpåhvorstortvæskeinntaketmåværeforågjenopprette væskeballansen.entommelfingerregelsieratvæskeinntaketbørvære150%av væsketapet.fordeflestetilsvarerdetetvæskeinntakpåminst5dlumiddelbartetter økten,ogderettermindremengderfordeltoverdenestetotimene,inntil væskeballansenergjenopprettet.utøverenersomregelivæskeballansenårurinener tilnærmetvannfarge. Forogsikreoptimalkarbohydratlagringskalutøvereninnta1 1,5gramkarbohydratper kilogramkroppvekstsværtraskt,senestiløpetavdenførstehalvtimenetteraktiviteten. Dissekarbohydratenebørværelettereåtaopp,ogdekankommefrabådedrikkeog mat.inntakavproteinrettettertreningerviktigfordidetstimulererbåde proteinsyntesen(reperasjonavmuskelvev)oglagringenavkarbohydrater.proteininntak hareffektførstogfremstvedtreningsøktermedstortotaltreningsbelastning,ogved styrketrening.utøverenbørinnta10 20gramproteiniformavdrikkeellermatsenest30 minutteretterallesliketreningsøkterogkonkurranser. 32

33 90-95% restitusjon 100% retitusjon Varighet av (ufullstendig) (fullstendig) overkompensasjonsfasen I-sone 1 fortløpende/ fortløpende eller opp til et par døgn noen timer opp til 36 timer I-sone timer timer 1-3 døgn I-sone 3 12 timer timer 2-4 døgn I-sone timer timer 3-5 døgn I-sone timer timer 3-6 døgn I-sone timer timer 3-6 døgn I-sone timer timer 3-6 døgn I-sone timer timer 3-6 døgn Figur10 restitusjonstid(frahallen2008:fysisktreningifotball) 2.5 Frastudien High intensitytraininginfootballplayers FrancoM.ImpellizzeriharIsindoktoravhandling High intensitytraininginfootball players effectsonphysicalandtechnicalperformance,gjennomførtenstudiehvorhan undersøktehvilkeneffektøvelsestype,banestørrelseogtrenerpåvirkninghaddepå intensitetogreproduserbarhetismåspill(imperllizzeri2009).datablesamletinnpå20 amatørspillere,medgjennomsnittsvekt73kg,gjennomsnittshøyde1,79mog gjennomsnittsalder24,5.populasjonsutvalgethaddegjennomsnittsvo2maxpå56,3. Studienefokusertepåspill3:3,4:4,5:5,6:6påtreulikebanestørrelsermedoguten trenerpåvirking(motiverendetilrop). Størrelser Spill Liten Middels Stor 3 mot 3 12 x 20 m 15 x 25 m 18 x 30 m 4 mot 4 16 x 24 m 20 x 30 m 24 x 36 m 5 mot 5 20 x 28 m 25 x 35 m 30 x 42 m 6 mot 6 24 x 32 m 30 x 40 m 36 x 48 m Figur11 33

34 Kamplengdenvar4minuttermed3minutteraktivpause.Detblespilt 4x4 kamper. Hjertefrekvens(HR), ratingofperceivedexertion (RPE)påCR10 skalaenogblodlaktat blemålt(rpe:subjektivtopplevdintensitet1 10). Figur12:Variasjonerav5:5og6:6. MålingenetilImpellizzerivisteatdetblehøyestintensitet,RPEogblodlaktatved3:3med storbanestørrelse.storforskjelliblodlaktaterverdtåmerkesegmedtankepå akkumuleringavlaktatiblodogmuskel.impellizzeribenytterlaktatterskelpå2.5 4mmol idennestudien,mensendelannenlitteraturogundersøkelservilbenytteandreverdier. Ved6:6varlaktatmålingen3,4mmolog6,5mmolved3:3.Dvsatdeved3:3har akkumulertsyreogfåttstivebeine.detteførtesannsynligvisdårligereprestasjonsevne. Ved coachencouragment visesdetenrelativtlitenøkningipuls(89,1til90,9%av maxhr),mentrenerenspåvirkninggirenrelativtstorendringilaktat(5 6,5mmol). Detteertallfrastorbane3:3. KonklusjoneniImpellizzerisstudie,viseratågjøreendringeribanestørrelse,øvelsestype (3:3vs6:6)ogtrenerfeedback,kanintensitetenpåvirkes(sefigur). 34

35 Hjertefrekvens (% av maksimal) Belastning i soner Spill Størrelse m/coatching u/coatching m/coatching u/coatching 3 mot 3 liten 89,5 87,6 6 4,4 middels 90,5 88,6 6,3 4,6 stor 90,9 89,1 6,5 5 4 mot 4 liten 88,7 86,5 5,3 4,2 middels 89,4 86,7 5,5 4,3 stor 89,7 87,2 6 4,7 5 mot 5 liten 87,8 86 5,2 3,9 middels 88,8 86,1 5 4,1 stor 88,8 86,9 5,8 4,6 6 mot 6 liten 86,4 83,8 4,5 3,4 middels 87 85,1 5 3,9 stor 86,9 85 4,8 3,6 Figur13 Vedåbrukeulikekombinasjoneravdissefaktorenekantreneremodulereintensitetenog kontrolleredenaerobetreningspåvirkningeninnenforhøyintensitetssonen(impellizzeri 2009). 3.0 METODEogGJENNOMFØRING Metodeer,ifølgeHalvorsen(1993:15),snevertdefinert"denhåndverksmessigesidenav vitenskapeligvirksomhet,ellermerpresistlærenomdeverktøysomkan benyttesforåinnsamleinformasjon".dettekapittelettarforsegmetodensomerblitt benyttetiforbindelsemedgjennomføringenavmineundersøkelser. 35

36 3.1 Metodologiensdesignogutforming Innhentingavinformasjonfraulikekildererenviktigforutsetningforenoppgavesom dette.enhveroppgavekreverogsågjennomgangavdemetodersomernødvendigfor arbeidetmedtemaet. Foråfinneteoritiloppgavenminvarfaglitteraturogsamtalermedtoppidrettsmiljøeti Olympiatoppenviktigearenaer.Tipstillitteraturfikkjegogsåavulikepersonerjeghadde samtalermed,foreksempelsigmundaasen. Tilempiridelenvalgtejegåintervjuefirefysisketrenereinorsktoppfotballfrafireulike klubber,samtåinnhentenoetestmateriellsometutgangspunktforådrøfte problemstillingen.begrunnelsenforvalgavfireforskjelligetrenere,bunnerprimærti oppgavensomfang.valgavtrenereogklubbervarnoetilfeldigettersomdetvarmiljøer jegfikkinnspillpååkontakte.poengetformindelvarikkeågeneralisere,menheller skaffeetempiriskgrunnlagforålærenoe,ogkunnebelysenoentendenserjegfinneri klubbeneshverdag.dettevilgjenspeileforholdetmellomteoriogpraksis.jegopplevde positivitethosdeklubbenejegkontaktet,ogjegvarpåbesøkitoavdisse(rosenborgog Brann)oggjennomførtesamtaler/intervjupåtelefonmedStrømsgodsetogOdd Grenland. Detvarpåtoområdermineundersøkelserhaddefokuspåforåfåbelystmin problemstilling.pådenenesidenvillejeghenteinnerfaringerogresultateromkring hvordanulikeklubberinorsktoppfotballdriverfotballspesifikkfysisktrening,hvordan dissebyggeroppukesyklusogøvelsesutvalgknyttettildette.dettevillejegogså sammenlignemeddebesteiverden,ogsåiandreidretter.dessutenvillejegbenytte egneerfaringerfrateoriogåprøvedetteutsystematiskitreningsprosesseniløv Ham Fotballi2009. Måletmedmineundersøkelservarålæremeromhvordanfotballspesifikkfysisktrening kangidetbesteutbyttet.hervarimpellizzerisundersøkelseenreferanseformegimitt møtemedandreklubbmiljøer. 36

37 3.1.1 Kvalitativtogkvantitativt Innhentingavinformasjonkanbådehakvalitativtogkvantitativtpreg.Idenneoppgaven harjegbenyttetmegnestenutelukkendeavførstenevntekategori.jegvilidetfølgende sinoemeromminemetoder,ogpåbestemåteklassifisereogbegrunnedisse setti forholdtilaktuellteori,ogretningslinjerjegharfåttiforholdtiloppgaven. "Atställafrågoräroftadetlettastesättetatfåinformationom hurenpersonuppfattarellerkännerinförenföreteelseviintresserar ossför.(lantz1993:11). Intervjuharværtdeneneavminemåteråinnhenteinformasjonpå,menintervjusom samlebetegnelsekanrommebådekvalitetogkvantitet.medutgangspunktia.t. Lotherington,"Intervjusommetode"(1990),finnerjegstøtteforetskillemellomto intervjumetoder(s.1): "(...)kvalitativtintervju,detvilsi,deteropptildensomblirintervjuet åformuleresvarene.detteimotsetningtilkvantitativesombruker spørreskjemamedfastlagtesvaralternativ.idenførstetypenintervjuer viopptattavåforståintervjukandidatenskategoriseringavsin virkelighet,mensviidenandreeropptattavåfåintervjukandidatentil åplasseresinvirkelighetivårekategorier."(lotherington1990:1) Jegserutfradetteatjegharbenyttetmegavkvalitativmetodeforåsamleinformasjon gjennomintervjuer. Foråfåfremuliketestresultatersomkansupplereogunderstrekeintervjuene,harjeg benyttetmegavkvaltitativeundersøkelser.medklarevariabler,harjeginnhentetulike testresultaterellerforetatttestingselvmedbrukavdigitalehjelpemidler.disse undersøkelsene,hvorjeghargjennomførttestutføringererkvalitativemetoder.dette harværtgjortforåutfylledekvalitativeintervjuene.dermedhardetometodeneutfylt 37

38 hverandre,ogværtmedåhjelpemegtilåfåenkombinasjonavoversiktoginnsikt,noe somharværtavstorbetydning Kvalitativeintervjuer Jegtokibrukkvalitativtintervjublantdefysisketrenernejegintervjuetinnenforå kartleggehvordanklubbendriverfysisktrening.somforberedelsetildetteintervjuet, haddetrenernefåttendelinformasjonavmegpåtelefonomkringhvajegvaropptattav. Lotherington(1990)omtalertreulikeintervjutyper: Detuformelle,samtalendeintervjuet Detteintervjuetforegårsomensamtale.Påforhånderdetikkeavtaltatdeteret intervju,slikatsamtalepartnerenkanværeuvitendeomathaneriintervjusituasjonen. Dennetypenintervjugjørdetikkemuligåsetteoppenlistemedspørsmålpåforhånd, fordiintervjuereniforkantikkekanvitehvasomskjer,oghvadetkanblivesentligå spørreom.intervjuformenkreveratforskerenienperiodeertilstedeisituasjonen,ogat hanmåforetaettellertointervjuermedhverperson.denneformenerderformyebrukti forbindelsemeddeltakendeobservasjon.fordeleneratenletterekankommepå innsidenavintervjukandidaten,nettoppvedatenkjennertilkonteksten.detvilkreve sværtmyetidomenskalfåinnsystematiskinformasjon. Intervjuguidetilnærmingen Herharensattoppspørsmålellertemapåforhånd.Dennelistenkanfungeresomen sjekklisteellerhuskeliste.meningeneratintervjuerenformulererspørsmålunderveis,og eropptattavåfølgeoppdetintervjukandidatensier.intervjuetkanforegåmereller mindresomensamtale. Standardisertopen endedintervju Herharenettsettmednøyeuttenktespørsmål.Spørsmåleneerlagetmedtankepåat hverenkeltsomharblittintervjuetskalspørresomdetsamme,medsammeord,isamme rekkefølge.detbrukesnårdeterviktigåminimalisereulikheterispørsmålenesomstilles 38

39 tilintervjukandidatene.dettevilværespesieltaktueltderdeterflereforskjellige Skriftlig oppgave intervjuere.intervjuernesinnvirkningpåintervjukandidatvilreduseres,ogbearbeidingog videreanalyservilbligreiereennmed"løsere"spørsmål.fleksibilitetenreduseres imidlertid,ogmulighetenforoppfølgingsspørsmålreduseres,settiforholdtildenforrige formen. Intervjueneminevarnøyeforberedt.Jeghaddeenklaroppfatningavhvajegønsketå finnesvarpå,menvarsamtidigåpenforatjegkunnefåvitemer.derforlagetjegen huskerammepåforhånd,menutenåsetteoppklarespørsmålsformuleringer.samtidig varjegopptattavåfåskaptengod,flytendesamtaleomkringtemaene.mittmålvaråfå tiletintervjumedetuformeltogåpentpreg.detteønsketbunneriselvegrunnentil samtalen,jegvaruteetterålærenoe,ogfåetempiriskgrunnlagforvideredrøftinger. Utgangspunktetmåttederforværeydmykhetframinside. Spørsmålomhvorvidtjegskullebrukelydbåndunderintervjuetblediskutertpåforhånd. Utfratidligereerfaring,harjegsettatdetteerentidkrevendemetode,ogvalgtederforå sebortfradette. JegvilnåkommetilbaketilA.T.Lotherington(1990)sinetreintervjutyper,somjeg omtaltetidligereidetteavsnittet.dettegjørjegforåklassifisereminegenmetode. ILotheringtonsframstillingpoengteresdetatdetretypeneintervjukanlaseg kombinere.detteerogsåaktueltiforholdtilmineintervjuer.jegkombinertedeto førstenevnteintervjutypene.dajegmøttemineintervjuobjektervardetikkeframinside sagttydeligatjegskullehaetintervju,menmeratjegvillelærenoe.detteuformelle, samtalendeintervjuetblelikevelstrukturertgjennomminforhåndsoppførtesjekkliste somdelvisgårinnunderintervjuguidetilnærmingen.avsatttidtilintervjuetvari underkantaventime. 39

40 3.1.2Kvalitativeundersøkelser Jegvilleundersøkehvordanendringavforutsetningerinnenfordenfotballspesifikke fysisketreningensomblirutførtinorsktoppfotball,kunneendredetfysiskeutbyttet. Dermedkunnejegførstseomjegfikklignenderesultaterinnenfordesammeøvingene sombleskissertisamtalermeddefysisketrenerne,ogjegkunnegjøreendringerpådisse øvingeneforåsehvordandetteendretdetfysiskeutbyttet.herbenyttetjegmegav pulsmåleresomregistreringogfulgtedetenkelteforsøktettopppåengrundigog kvalitativmåte.jegvartilstedeiutprøvingen,ogdettemenerjegermedpåågjøre undersøkelsenmerpålitelig,idengradatevt.spørsmålsomdukketoppfårgradav sammesvar.dettemenerjegeretbidragtilågiundersøkelsenmerhold. Drøftingeneminevilkanskjeværeenkildetilnyeideer,vedatjegstillerspørsmåltil dagenspraksis.detåværeoppmerksompåspenningenmellomteoriogpraksis,kan kanskjeføremedsegnødvendignytenkninginnifysisktrening. Jegharbevisstbruktdennetankegangensomendelavmetoden,foråforsikremegom atjegikkeharutelattnoenviktigedeleravetlagshverdag,somkanhaavgjørende betydningforminedrøftingerogkonklusjon.samtidigviserdenatjegiarbeidetharvært innomallenivåeneforåhenteinnkildemateriale. 3.3 Vurderingavundersøkelsenskvalitet "Validitetenavhengeravhvadetersomermålt,omdetteerde egenskapeneproblemstillingengjelder.validitetenbetegneraltså datasrelevansforproblemstillingeniundersøkelsen."(hellevik1991:159). Formåletmedmineundersøkelservaråsamleinndatasomgavmegmulighettilå evaluereellervurderehvordandettrenesfotballspesifiktfysiskinorsktoppfotball,samt hvordanendringavforutsetningerkunneskapeendringerispillernesfysiskeutbytte. "Evalueringersystematiskinnsamlingavdataforåskiljaoganalysereverknadenaveit forsøkpååskapeendringpåeitgittområde"(halvorsen1993:70). 40

Arbeidsøkonomi: Arbeidsøkonomi er et mål på hvor mye energi en utøver forbruker på en gitt intensitet eller tilbakelagt distanse (teknikk)

Arbeidsøkonomi: Arbeidsøkonomi er et mål på hvor mye energi en utøver forbruker på en gitt intensitet eller tilbakelagt distanse (teknikk) PRESTASJONSUTVIKLING BEGREPSAVKLARING Aerob kapasitet: Aerob kapasitet representerer den totale aerobe energiomsetningen (oksygenopptaket) under en aktivitet og i løpet av en definert tidsperiode (VO 2

Detaljer

INTENSITETSSONER. Olympiatoppen anbefaler at treningen deles inn i åtte intensitetssoner Inndelingen i de åtte intensitetssonene er gjort ut fra:

INTENSITETSSONER. Olympiatoppen anbefaler at treningen deles inn i åtte intensitetssoner Inndelingen i de åtte intensitetssonene er gjort ut fra: INTENSITETSSONER Olympiatoppen anbefaler at treningen deles inn i åtte intensitetssoner Inndelingen i de åtte intensitetssonene er gjort ut fra: hensikten med treningen i hver intensitetssone hvordan ATP

Detaljer

Et godt resultat. er konsekvensen av. En god prestasjon. er konsekvensen av. med. Foredrag sykkeltrening av Atle Kvålsvoll.

Et godt resultat. er konsekvensen av. En god prestasjon. er konsekvensen av. med. Foredrag sykkeltrening av Atle Kvålsvoll. Et godt resultat er konsekvensen av En god prestasjon er konsekvensen av Riktig aktivitet med Riktig kvalitet OLT s tilnærming til prestasjonsforbedring -på individnivå- Sette mål Tydeliggjøre krav Evaluere

Detaljer

Norges Skøyteforbund. Utholdenhet/intensitetssoner

Norges Skøyteforbund. Utholdenhet/intensitetssoner Norges Skøyteforbund Utholdenhet/intensitetssoner Begrepsavklaring Aerob kapasitet: - Aerob kapasitet representerer den totale aerobe energiomsetningen (oksygenopptaket) under en aktivitet og i løpet av

Detaljer

Sykkeltrening. Atle Kvålsvoll

Sykkeltrening. Atle Kvålsvoll Sykkeltrening Atle Kvålsvoll Aktiv syklist 1977-1994 Proff syklist 1988-1994 Sportssjef med treneransvar NCF 1995-2000 Leder OLT Midt Norge 2001-2006 Trener Thor Hushovd 2003Coach utholdenhet OLT 2005Daglig

Detaljer

Olympiatoppens Intensitetssoner

Olympiatoppens Intensitetssoner Olympiatoppens Intensitetssoner Sone 1 og 2 Sone 1, 55-72 % av maks hjertefrekvens En intensitet en trent utøver kan holde i flere timer. «Pratefart» Fett er brennstoffet både i sone 1 og sone 2 og en

Detaljer

Leif Inge Tjelta: Utholdenhet og. utholdenhetstrening

Leif Inge Tjelta: Utholdenhet og. utholdenhetstrening Leif Inge Tjelta: Utholdenhet og utholdenhetstrening Utholdenhet (definisjon) Evne til å motstå tretthet Å opprettholde en gitt intensitet (styrkeinnsats, fart, etc) begrenses av graden av tretthet og

Detaljer

Intensitetssoner (Olympiatoppen)

Intensitetssoner (Olympiatoppen) Intensitetssoner (Olympiatoppen) Her er en oversikt basert på treningserfaringer og teori utarbeidet av olympiatoppen Innformasjonen her er hentet fra boken "Utholdenhet, trening som gir resultater" og

Detaljer

Hvordan trener verdens beste utholdenhetsutøvere, og hva kan vi lære av dem?

Hvordan trener verdens beste utholdenhetsutøvere, og hva kan vi lære av dem? Hvordan trener verdens beste utholdenhetsutøvere, og hva kan vi lære av dem? I den senere tid har enkelte forskningsmiljøer i Norge hevdet at trening med lav intensitet ikke har effekt, og at trening med

Detaljer

Treningssider. denne artikkelen vil jeg ikke ta stilling til om påstanden er riktig eller gal, men kun kort presentere hvordan

Treningssider. denne artikkelen vil jeg ikke ta stilling til om påstanden er riktig eller gal, men kun kort presentere hvordan Hvordan trener verdens beste utholdenhetsutøvere? I den senere tid har enkelte forskningsmiljøer i Norge hevdet at trening med lav intensitet ikke har effekt, og at trening med høy intensitet er tilstrekkelig

Detaljer

Hvorfor ble de beste best? En casestudie av tre kvinnelige verdensenere i orientering, langrenn og langdistanseløp

Hvorfor ble de beste best? En casestudie av tre kvinnelige verdensenere i orientering, langrenn og langdistanseløp Hvorfor ble de beste best? En casestudie av tre kvinnelige verdensenere i orientering, langrenn og langdistanseløp Espen Tønnessen Fagsjef for trening ved Olympiatoppen olympiatoppen 22. februar 2011 side

Detaljer

BASISÅR I IDRETTSVITENSKAP 2011/2012. Utsatt individuell skriftlig eksamen. i IDR 120- Naturvitenskapelige perspektiver på idrett 1 - treningslære 1

BASISÅR I IDRETTSVITENSKAP 2011/2012. Utsatt individuell skriftlig eksamen. i IDR 120- Naturvitenskapelige perspektiver på idrett 1 - treningslære 1 BASISÅR I IDRETTSVITENSKAP 2011/2012 Utsatt individuell skriftlig eksamen i IDR 120- Naturvitenskapelige perspektiver på idrett 1 - treningslære 1 Tirsdag 28. februar 2012 kl. 10.00-13.00 Hjelpemidler:

Detaljer

Leif Inge Tjelta: Utholdenhet og. utholdenhetstrening

Leif Inge Tjelta: Utholdenhet og. utholdenhetstrening Leif Inge Tjelta: Utholdenhet og utholdenhetstrening Utholdenhet (definisjon) Evne til å motstå tretthet Å opprettholde en gitt intensitet (styrkeinnsats, fart, etc) begrenses av graden av tretthet og

Detaljer

Treningslærekurs på NIAK

Treningslærekurs på NIAK Treningslærekurs på NIAK Emner: Treningsplanlegging Olympiatoppen, høsten 2014 Av: Espen Tønnessen Hva er treningslære? Definisjon Treningslære er læren om idrettstrening og forhold som er avgjørende for

Detaljer

BASISÅR I IDRETTSVITENSKAP 2011/2012. Individuell skriftlig eksamen. i IDR 120- Naturvitenskapelige perspektiver på idrett 1 - treningslære 1

BASISÅR I IDRETTSVITENSKAP 2011/2012. Individuell skriftlig eksamen. i IDR 120- Naturvitenskapelige perspektiver på idrett 1 - treningslære 1 BASISÅR I IDRETTSVITENSKAP 2011/2012 Individuell skriftlig eksamen i IDR 120- Naturvitenskapelige perspektiver på idrett 1 - treningslære 1 Mandag 12. desember 2011 kl. 10.00-13.00 Hjelpemidler: ingen

Detaljer

b) Gjør rede for hvordan du lager en helhetlig treningsplan. Ta utgangspunkt i begreper som arbeidskravsanalyse og kapasitetsanalyse.

b) Gjør rede for hvordan du lager en helhetlig treningsplan. Ta utgangspunkt i begreper som arbeidskravsanalyse og kapasitetsanalyse. Oppgave 1: a) Gjør rede for grunnleggende prinsipper for trening. b) Gjør rede for hvordan du lager en helhetlig treningsplan. Ta utgangspunkt i begreper som arbeidskravsanalyse og kapasitetsanalyse. Oppgave

Detaljer

Norges Skøyteforbund Generell treningslære

Norges Skøyteforbund Generell treningslære Norges Skøyteforbund Generell treningslære Trener I Basis egenskaper skøyter Utholdenhet Styrke Hurtighet (fart) Fleksibilitet Koordinasjon (TEKNIKK) TRENINGSFORMER 1. Generell trening: Trener hele kroppen

Detaljer

TRENINGSVEILEDER ISHOCKEY del 1 treningsplanlegging

TRENINGSVEILEDER ISHOCKEY del 1 treningsplanlegging TRENINGSVEILEDER ISHOCKEY del 1 treningsplanlegging Innhold PLANSYKLUSEN... 2 ÅRSPLAN... 3 PERIODEPLAN... 4 1 Plansyklusen Behovet for systematisk treningsplanlegging følger som en konsekvens av klubbens

Detaljer

Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2006

Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2006 Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2006 Harald Munkvold 1 Hva er utholdenhet Utholdenhet defineres som organismens evne til

Detaljer

Treningslærekurs på NIAK

Treningslærekurs på NIAK Treningslærekurs på NIAK Emne: Spensttrening Av: Espen Tønnessen Dagens tema spensttrening: 1. Hva er spenst? 2. Hvilke faktorer bestemmer vår spenst? 3. Hvilke krav stilles det til spenst i idrett? 4.

Detaljer

Bacheloroppgave. Elitesvømmeres subjektive oppfattelse av intensitet. av Bendik Durmisi Ahlstrøm Lars Henrik Skau Innleveringsfrist: 18.05.

Bacheloroppgave. Elitesvømmeres subjektive oppfattelse av intensitet. av Bendik Durmisi Ahlstrøm Lars Henrik Skau Innleveringsfrist: 18.05. Bacheloroppgave Elitesvømmeres subjektive oppfattelse av intensitet av Bendik Durmisi Ahlstrøm Lars Henrik Skau Innleveringsfrist: 18.05.2015 VF200 -Vitenskapsfilosofi Bachelor i osteopati Antall ord:

Detaljer

Hvordan forebygge løpeskader? Kenneth Myhre - kennethmyhre@outlook.com

Hvordan forebygge løpeskader? Kenneth Myhre - kennethmyhre@outlook.com Hvordan forebygge løpeskader? Agenda Hva er en løpeskade? Noen viktige treningsprinsipper Innhold og oppbygning av program Løpeteknikk Noen enkle råd på veien Hva er en «løpeskade»? All trening er belastning.

Detaljer

Optimalisering av utholdenhetstrening!

Optimalisering av utholdenhetstrening! .9. Optimalisering av utholdenhetstrening! Agenda Intensitetsstyring Hvordan trener de beste? Hva kan du lære av de beste? Formtopping Av Øystein Sylta oysteinsylta@hotmail.com CV Øystein Sylta Utdanning:

Detaljer

TRENINGSVEILEDER ISHOCKEY del 3 Øvelsesbank fystrening

TRENINGSVEILEDER ISHOCKEY del 3 Øvelsesbank fystrening TRENINGSVEILEDER ISHOCKEY del 3 Øvelsesbank fystrening Treningsveilederen er et treningsfaglig grunnlag for optimal prestasjonsutvikling i Ishockey. Del 3 beskriver styrkeøvelsene og intensitetsstyring

Detaljer

Hvilke dager skal du trene? Om intensitetssoner

Hvilke dager skal du trene? Om intensitetssoner Dette er programmet for deg som ønsker å komme i bedre løpeform, og har som mål å trene tre løpeøkter i uka. Ukenummer refererer til ukenummer i kalenderen. Dette programmet går fra uke 21 til 40. Begynn

Detaljer

3. Ved hvor mange repetisjoner i styrketrening opphører forbedring av styrke (1RM)? a) ca 15 b) ca 40 c) ca 6 d) ca 100

3. Ved hvor mange repetisjoner i styrketrening opphører forbedring av styrke (1RM)? a) ca 15 b) ca 40 c) ca 6 d) ca 100 1. Newton s 2.lov Kraft = masse x akselerasjon tilsier at hvis en idrettsutøver øker styrken/kraftutviklingen sin med 30% uten å øke kroppsvekten, hvor mye fortere løper han en 10m sprint? a) 10% b) 30%

Detaljer

Samarbeidsprosjektet treningskontakt

Samarbeidsprosjektet treningskontakt Samarbeidsprosjektet treningskontakt - en videreutvikling av støttekontaktordningen Utholdenhetstrening Lisa Marie Jacobsen Fysioterapeut Mål for undervisningen Få et innblikk i hva utholdenhetstrening

Detaljer

Samarbeidsprosjektet treningskontakt

Samarbeidsprosjektet treningskontakt Samarbeidsprosjektet treningskontakt - en videreutvikling av støttekontaktordningen Utholdenhetstrening Lisa Marie Jacobsen Fysioterapeut Mål for undervisningen Få et innblikk i hva utholdenhetstrening

Detaljer

Fase 2 Utarbeiding av treningsplaner. Langsiktige og kortere delplaner.

Fase 2 Utarbeiding av treningsplaner. Langsiktige og kortere delplaner. Treningsplanlegging 1 Både mosjonister og aktive idrettsutøvere kan ha fordeler av å planlegge sin trening. En kan planlegge trening på kort- og lang sikt. På lang sikt kan en lage årsplaner og på kort

Detaljer

FAGSEMINAR

FAGSEMINAR FAGSEMINAR 04.09.2010 Ødelegger styrketrening for utholdenhet og omvendt? Olympiatoppen Alexander R.Wisnes .eller omvendt Kan vi få bedre utholdenhet ved å trene styrke i tillegg til utholdenhetstrening?

Detaljer

Leif Inge Tjelta: Utholdenhetstrening

Leif Inge Tjelta: Utholdenhetstrening Leif Inge Tjelta: Utholdenhetstrening 1 Hva jeg skal snakke om Fysiologiske faktorer som er avgjørende for prestasjonsnivået i utholdenhetsidretter Hva skjer som følge av trening? Hvordan trener eliteutøvere?

Detaljer

Intensitetsstyring m pulsklokke www.arildtveiten.com

Intensitetsstyring m pulsklokke www.arildtveiten.com Skedsmo 11.02.08 Intensitetsstyring m pulsklokke Utholdenhet: -Evnen til å arbeide m relativt høy intensitet over lengre tid. Aerob Utholdenhet Anaerob utholdenhet Aerob/anaerob: Enebakk Rundt mm: minst

Detaljer

IDR108 1 Treningslære og fysiologi

IDR108 1 Treningslære og fysiologi IDR108 1 Treningslære og fysiologi Oppgaver Oppgavetype Vurdering 1 Oppgave 1 Skriveoppgave Manuell poengsum 2 Oppgave 2 Skriveoppgave Manuell poengsum 3 Oppgave 3 Skriveoppgave Manuell poengsum 4 Oppgave

Detaljer

Utholdenhet Trening som virker

Utholdenhet Trening som virker Utholdenhet Trening som virker Artikkelen er et sammendrag av boken som Olympiatoppen har utgitt om utholdenhetstrening. I artikkelen er det beskrevet hvilke fysiske faktorer som er prestasjonsbestemmende

Detaljer

Intensitetssoner ka e vitsen? Foredrag på «1. Wisnes-seminar» 22. November 2017 av Ørjan Madsen

Intensitetssoner ka e vitsen? Foredrag på «1. Wisnes-seminar» 22. November 2017 av Ørjan Madsen Intensitetssoner ka e vitsen? Foredrag på «1. Wisnes-seminar» 22. November 2017 av Ørjan Madsen Innhold Alex og meg et kort tilbakeblikk Historikk utviklingen av intensitetssoner - intensitetsskala Intensitetssoner,

Detaljer

Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2013

Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2013 Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2013 Harald Munkvold 1 Fysisk aktivitet -er alle kroppslige bevegelser som resulterer i

Detaljer

GJØR DEG KLAR! Svein Roar Kvamme, Personlig Trener Sprek og Blid Knarvik

GJØR DEG KLAR! Svein Roar Kvamme, Personlig Trener Sprek og Blid Knarvik GJØR DEG KLAR! Svein Roar Kvamme, Personlig Trener Sprek og Blid Knarvik KLAR PÅ 26 UKER BESKRIVELSE AV INTENSITETEN PÅ ØKTENE Jeg kommer til å bruke puls- og soneinndeling som beregnes i forhold til din

Detaljer

Arbeidskrav og rammeplaner for en internasjonal 5000m løper

Arbeidskrav og rammeplaner for en internasjonal 5000m løper Arbeidskrav og rammeplaner for en internasjonal 5000m løper I denne artikkelen vil vi skissere hvilke krav som stilles til en mannlig 5000 meter løper på internasjonalt nivå. På bakgrunn av de fysiske,

Detaljer

Generelt deler vi inn økter og soner som følger:

Generelt deler vi inn økter og soner som følger: Treningsøkter, en beskrivelse. For at vi skal snakke samme språk kommer det her en beskrivelse av treningsøkter. Treningsprogram / økter deles inn etter hensikten med økta. Vi benytter navn som under.

Detaljer

Styrketrening for syklister

Styrketrening for syklister Styrketrening for syklister Styrketrening - all trening som har til hensikt å bedre vår muskulære styrke (Raastad 2000) Hensikt - Bedre prestasjonsevne på sykkel Styrketrening for syklister Nyere forskning

Detaljer

Hva skal til for å nå toppen?

Hva skal til for å nå toppen? Prestasjonsbestemmende faktorer Tålmodighet: Det tar tid å nå toppen, enten det handler om det øverste trinnet på seierspallen eller toppen av Fanaråken. I idretter som løping, sykling, langrenn og andre

Detaljer

Kondisjons- og utholdenhetstrening

Kondisjons- og utholdenhetstrening Kondisjons- og utholdenhetstrening Jostein Hallén, Norges Idrettshøgskole Utholdenhet er viktig i de fleste idretter, og alle idrettsutøvere føler at god kondisjon er en forutsetning for å prestere godt

Detaljer

Legg puslespillet riktig!

Legg puslespillet riktig! Tren optimalt: Legg puslespillet riktig! [ingress] Fysioterapeuter er sentrale fagpersoner ved opptrening og rehabilitering etter overbelastninger og skader både for mosjonister og toppidrettsutøvere.

Detaljer

Testing. En kort orientering om testing av utholdenhet ved Idrettssenteret. Asgeir Mamen

Testing. En kort orientering om testing av utholdenhet ved Idrettssenteret. Asgeir Mamen Testing En kort orientering om testing av utholdenhet ved Idrettssenteret Asgeir Mamen Erklæring om testing Erklæring i forbindelse med undersøkelser ved Fysiologisk laboratorium, Idrettssenteret, 6851

Detaljer

EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2013.

EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2013. EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2013. Hver oppgave gir ett poeng, og har kun ett riktig svar. Det gis ikke trekk for feil svar. Oppgavearket

Detaljer

4. Målinger av lungefunksjon ble i studiet til Bjørgen et al. (2009) utført med a) Spirometri b) Inhalasjonsrespiratori c) Kalorimetri d) Geriatri

4. Målinger av lungefunksjon ble i studiet til Bjørgen et al. (2009) utført med a) Spirometri b) Inhalasjonsrespiratori c) Kalorimetri d) Geriatri 1. Maksimal styrketrening ga forbedringer i følgende fysiologiske parametre hos langdistanseløpere: a) AT og VO 2max b) RE og VO 2max c) VO 2max og MAS d) MAS og RE 2. Johnston et al (1997) viste at en

Detaljer

Basistrening. Teknikktrening Utholdenhetstrening

Basistrening. Teknikktrening Utholdenhetstrening Basistrening Teknikktrening Utholdenhetstrening Hva er teknikk? Med teknikk i idrett mener vi utøverens løsningl av en gitt bevegelsesoppgave Teknikk i idretten Hensiktsmessig bevegelsesløsning Effektiv

Detaljer

Eksamen MFEL1050 HØST 2012

Eksamen MFEL1050 HØST 2012 Eksamen MFEL1050 HØST 2012 1. Hva er hypertrofi? a) Flere aktin og troponin proteintråder i parallell b) Flere aktin og myosin proteintråder i parallell c) Flere transkripsjoner av proteinene myoglobin

Detaljer

«Beste praksis og framtidig utviklingspoteniasial»

«Beste praksis og framtidig utviklingspoteniasial» Optimal trening i langrenn «Beste praksis og framtidig utviklingspoteniasial» Øyvind Sandbakk, PhD Endringer i idretten? Langrenn VO 2 peak VO 2 kinetic %VO 2 peak Performance VO 2 Aerobic metabolic

Detaljer

Utholdenhetstrening for unge utøvere

Utholdenhetstrening for unge utøvere Utholdenhetstrening for unge utøvere Aerob kapasitet er den viktigste prestasjonsbestemmende faktoren i typiske utholdenhetsidretter. Aerob utholdenhet er viktig i andre idretter også for å være trent

Detaljer

Gymnos Tema. Hvordan trener verdens beste utholdenhetsutøvere, og hva kan vi lære av dem?

Gymnos Tema. Hvordan trener verdens beste utholdenhetsutøvere, og hva kan vi lære av dem? Hvordan trener verdens beste utholdenhetsutøvere, og hva kan vi lære av dem? Hvordan kan vi drive orienteringsopplæring i et lite nærterreng der det ikke er orienteringskart? Gymnos Tema 1 2007 Hvordan

Detaljer

Års- og periodeplaner på 400m

Års- og periodeplaner på 400m Års- og periodeplaner på 400m Tabell 1: Veiledende års- og periodeplan for en fremtidig 400m løper i aldersklassen 13-14 år Treningsdager 20 80 30 60 145/ 3 Treningsøkter 20 80 30 60 145 / 3 Treningstid

Detaljer

Prestasjonsrettet hurtighetstrening

Prestasjonsrettet hurtighetstrening Prestasjonsrettet hurtighetstrening Hvordan trene hurtighet på en effektiv måte? Hurtighetstrening i lagballspill og friidrett Av: Espen Tønnessen Sett inn video Hurtighetstrening Sochi Dagens tema Hurtighetstrening:

Detaljer

Hvordan trener verdens beste utholdenhetsutøvere? Espen Tønnessen Fagsjef i utholdenhet i Olympiatoppen

Hvordan trener verdens beste utholdenhetsutøvere? Espen Tønnessen Fagsjef i utholdenhet i Olympiatoppen Hvordan trener verdens beste utholdenhetsutøvere? Espen Tønnessen Fagsjef i utholdenhet i Olympiatoppen olympiatoppen 6. desember 215 side 1 Hvordan har norske verdensmestere i typiske utholdenhetsidretter

Detaljer

TRENINGSPROGRAM JEGERTROPPEN 10 UKER MOT OPPTAK

TRENINGSPROGRAM JEGERTROPPEN 10 UKER MOT OPPTAK TRENINGSPROGRAM JEGERTROPPEN 10 UKER MOT OPPTAK INNLEDNING Treningsprogrammet er ment som et verktøy for jenter som ønsker å søke Jegertroppen ved FSK. Hensikten med programmet er å forberede den enkelte

Detaljer

Samarbeidsprosjektet treningskontakt

Samarbeidsprosjektet treningskontakt Samarbeidsprosjektet treningskontakt - en videreutvikling av støttekontaktordningen Styrketrening Lisa Marie Jacobsen Fysioterapeut Mål med undervisningen Få et innblikk i Hva styrketrening er De ulike

Detaljer

BOBLE- ELLER MERCEDESMOTOR? ET SLAG FOR SLAGVOLUMET, MAKSIMAL STYRKE OG FOTBALL. Kjære skivenner!

BOBLE- ELLER MERCEDESMOTOR? ET SLAG FOR SLAGVOLUMET, MAKSIMAL STYRKE OG FOTBALL. Kjære skivenner! 1 av 6 2009-01-25 15:25 BOBLE- ELLER MERCEDESMOTOR? ET SLAG FOR SLAGVOLUMET, MAKSIMAL STYRKE OG FOTBALL Kjære skivenner! Da har dere vært lenge i gang med forberedelser til den kommende skisesongen med

Detaljer

Treningsprogram fram mot Oslo triathlon.

Treningsprogram fram mot Oslo triathlon. Vår samarbeidspartner Polar har sammen med triathlonlegende Arild Tveiten fått utarbeidet et forslag til trenings fram mot Oslo triathlon. I følge Tveiten skal selv nybegynnere innen triathlon klare sprint

Detaljer

Norvège 2007 Journée n 9 avril 02:01 02:04 03:00 01:00 03:00 01:01 10 avril 00:01 Journée n 14 avril 03:01 15 avril 00:01 03:00 04:03 01:01

Norvège 2007 Journée n 9 avril 02:01 02:04 03:00 01:00 03:00 01:01 10 avril 00:01 Journée n 14 avril 03:01 15 avril 00:01 03:00 04:03 01:01 Norvège 2007 Journée n 1 9 avril 101010 01 Nor Strömsgodset IF Odd Grenland 02:01 410341 01 Nor Aalesunds FK IK Start Kristiansand 02:04 450321 254141 01 Nor Lilleström SK Fredrikstad FK 03:00 145411 454524

Detaljer

Ved stor deltakelse kan det være aktuelt å dele i flere grupper for å øke treningsutbyttet for den enkelte.

Ved stor deltakelse kan det være aktuelt å dele i flere grupper for å øke treningsutbyttet for den enkelte. VEILEDENDE TRENINGSPROGRAM HØSTEN 2015 Da er vi i gang med forberedelser til vintersesongen 2015-2016. Det legges herved ut veiledende treningsprogrammer for følgende grupper: Gruppe1: Trener allsidig

Detaljer

Ernæringsavdelingen Olympiatoppen 1

Ernæringsavdelingen Olympiatoppen 1 Hva skaper en god utøver? Kosthold og prestasjon Marianne Udnæseth Klinisk ernæringsfysiolog Precamp EYOF 19.01.2011 Talent Trening Kosthold Restitusjon M0tivasjon Fravær av sykdom og skader Utstyr Olympiatoppen

Detaljer

Uke- og øktplaner for 400m (13-14 år)

Uke- og øktplaner for 400m (13-14 år) Uke- og øktplaner for 400m (13-14 år) Tabell 1: Veiledende uke- og øktplaner for en hard uke i forberedelsesperioden (oktober - november) : Fri Teknikk: Bevegelighet: Bevegelighet: Fri Fredag Fri Lørdag

Detaljer

Agenda. 1 Introduksjon. 3 Grunnleggende pulstrening 4 Praksis. o Cardio Trainer og DesiQner. - Suunto og Movescount. - Suunto; klokker og belter

Agenda. 1 Introduksjon. 3 Grunnleggende pulstrening 4 Praksis. o Cardio Trainer og DesiQner. - Suunto og Movescount. - Suunto; klokker og belter POWERED BY SUUNTO Agenda 1 Introduksjon - Suunto og Movescount - Suunto; klokker og belter - sportskompaniet.no - iqniter 2 iqniter o Cardio Trainer og DesiQner 3 Grunnleggende pulstrening 4 Praksis 3

Detaljer

Rye-Tempoen - 2011/2012 -

Rye-Tempoen - 2011/2012 - Rye-Tempoen - 2011/2012 - Velkommen Ressursgruppen Målsetning 2012 Hvordan oppnå dette? Rittprogram og samlinger Satsningsritt Samlinger Utstyr Praktisk informasjon Ny trener i Rye Agenda Ressursgruppen

Detaljer

Karbohydrater for maksimal prestasjon. Karbohydratlagre. Energilagre i kroppen. Glykogentømming under trening. Substrat metabolisme under trening

Karbohydrater for maksimal prestasjon. Karbohydratlagre. Energilagre i kroppen. Glykogentømming under trening. Substrat metabolisme under trening Karbohydrater for maksimal prestasjon Substrat metabolisme under trening Hvilke substrat oksideres i muskelceller under trening/konkurranse? Anu Koivisto Ernæringsavdeling, Olympiatoppen 2008 Kreatinfosfat

Detaljer

Tren smartere med Linda Wibe Namsvatn 2015

Tren smartere med Linda Wibe Namsvatn 2015 Tren smartere med Linda Wibe Namsvatn 2015 Kan toppidrettsutøvere og mosjonisten ha samme trener, er det de samme prinsippene? Mitt arbeidsverktøy Sette mål Tydeliggjøre krav Evaluere Måle ferdighet GAP

Detaljer

Treningslære 1 BELASTNING, TILPASNING OG PROGRESJON

Treningslære 1 BELASTNING, TILPASNING OG PROGRESJON Treningslære 1 BELASTNING, TILPASNING OG PROGRESJON TRE GRUNNPILARER I ALL TRENING «Én serie igjen! Dagens program har kostet krefter. Trening av maksimal styrke er krevende. Nå gjelder det å få opp fem

Detaljer

Fett kan forbrennes på mange måter, og det er bare opp til deg hvilken måte du velger.

Fett kan forbrennes på mange måter, og det er bare opp til deg hvilken måte du velger. Kondisjonstrening eller styrketrening? Når forbrenner du mer fett? Fett kan forbrennes på mange måter, og det er bare opp til deg hvilken måte du velger. 1) PULSSONER: SONE % av PULS MAKSIMUM 5 90-100%

Detaljer

EKSAMEN MFEL Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2014.

EKSAMEN MFEL Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2014. EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2014. Hver oppgave gir ett poeng, og har kun ett riktig svar. Det gis ikke trekk for feil svar. Sett

Detaljer

EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2009.

EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2009. EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2009. Hver oppgave gir ett poeng, og har kun ett riktig svar. Det gis ikke trekk for feil svar. Sett

Detaljer

Utviklingstrapp i orientering -bedre systematikk i treningsarbeidet

Utviklingstrapp i orientering -bedre systematikk i treningsarbeidet Utviklingstrapp i orientering -bedre systematikk i treningsarbeidet 6. Januar 2010 Anders Skjeset Innledning Utarbeidet av Erlend Slokvik, Egil Johansen, Jan Arild Johnsen og Bjørnar Valstad med bakgrunn

Detaljer

Utfordring med å bygge treningsplan,

Utfordring med å bygge treningsplan, Utfordring med å bygge treningsplan, Kun 3 fellestreninger, resten er opp til en selv Vi har KUN 3 felles treninger i uken Vi har begrenset tid til trening i løpet av høsten/vinteren (maks 1t 30) For noen

Detaljer

Optimalisering av sykkeltrening

Optimalisering av sykkeltrening Optimalisering av sykkeltrening Bent Rønnestad Høgskolen i Lillehammer Innhold Start tirsdag 18. november kl. 18.00: «Optimalisering av sykkeltrening» Kl. 18.00-18.50: Kort om sentrale faktorer for utholdenhetsprestasjon

Detaljer

Høgskolen i Telemark Avdeling for allmennvitenskapelige fag. Martin Hjort Sørensen Eirik Hanssen. Effekten av småbanespill på VO 2maks

Høgskolen i Telemark Avdeling for allmennvitenskapelige fag. Martin Hjort Sørensen Eirik Hanssen. Effekten av småbanespill på VO 2maks Mastergradsoppgave Martin Hjort Sørensen Eirik Hanssen Effekten av småbanespill på VO 2maks Høgskolen i Telemark Avdeling for allmennvitenskapelige fag Effekten av småbanespill på VO 2maks Martin Hjort

Detaljer

Treningsprogram for ressursperiode

Treningsprogram for ressursperiode Om treningsplanen I Rye deler vi treningsåret inn i 7 perioder som vist på figuren. Inndelingen sikrer en stigning i programmet frem mot konkurranseperioden(e). I første omgang har vi laget treningsprogram

Detaljer

Forespørsel om deltakelse i forskningsprosjektet

Forespørsel om deltakelse i forskningsprosjektet Forespørsel om deltakelse i forskningsprosjektet Effekten av karbohydrat og protein på utholdenhetsprestasjon ~18 timer etter en hard treningsøkt Bakgrunn og hensikt Dette er et spørsmål til deg om å delta

Detaljer

Tren smart og effektivt. Jill Jahrmann

Tren smart og effektivt. Jill Jahrmann Tren smart og effektivt Jill Jahrmann Innhold 1) Hva trenger kroppen for å trives? 2) Hva er viktigst, hverdagsaktivitet eller trening? 3) Treningsvane Trening, mosjon eller fysisk aktivitet? Intensitet

Detaljer

GJØR DEG KLAR! Svein Roar Kvamme, Personlig Trener Sprek og Blid Knarvik

GJØR DEG KLAR! Svein Roar Kvamme, Personlig Trener Sprek og Blid Knarvik GJØR DEG KLAR! Svein Roar Kvamme, Personlig Trener Sprek og Blid Knarvik KLAR PÅ 26 UKER BESKRIVELSE AV INTENSITETEN PÅ ØKTENE Jeg kommer til å bruke puls- og soneinndeling som beregnes i forhold til din

Detaljer

Fasit MFEL1050 høst 2010

Fasit MFEL1050 høst 2010 1. 1-MET økning i ytelse på tredemølle er assosiert med følgende forbedring i overlevelse: a. 3 % b. 12 % c. 24 % d. 48 % 2. En økning i MET er assosiert med: a. Redusert risiko for kreft, KOLS og hjerte

Detaljer

Treningsprogram for ressursperiode

Treningsprogram for ressursperiode Om treningsplanen I Rye deler vi treningsåret inn i 7 perioder som vist på figuren. Inndelingen sikrer en stigning i programmet frem mot konkurranseperioden(e). I første omgang har vi laget treningsprogram

Detaljer

Utholdenhet: Spenst: Styrke: Tirsdag. Teknikk: Hurtighetsutholdenhet: Utholdenhet: Spenst: Styrke:

Utholdenhet: Spenst: Styrke: Tirsdag. Teknikk: Hurtighetsutholdenhet: Utholdenhet: Spenst: Styrke: Uke- og øktplaner for 1500m (17-18 år) Tabell 1: Veiledende uke- og øktplaner i en hard uke i forberelsesperioden (oktober-november) Fredag Lørdag Hurtighets Hvile. Hvile evt. Langkjøring; 60 min/ 13 km

Detaljer

Samarbeidsprosjektet treningskontakt

Samarbeidsprosjektet treningskontakt Samarbeidsprosjektet treningskontakt - en videreutvikling av støttekontaktordningen Styrketrening Lisa Marie Jacobsen Fysioterapeut Mål med undervisningen Få et innblikk i Hva styrketrening er Positive

Detaljer

Treningslære - NIAK Test- og testprosedyrer

Treningslære - NIAK Test- og testprosedyrer Treningslære - NIAK Test- og testprosedyrer Av: Espen Tønnessen Testing av idrettsutøvere Hensikten med forelesningen er å gi en innføring i: Hvorfor man bør teste Hva som karakteriserer en god test Utarbeidelse

Detaljer

Norges Skøyteforbund. Styrke-, spenst-, hurtighets- og utholdenhetstrening

Norges Skøyteforbund. Styrke-, spenst-, hurtighets- og utholdenhetstrening Norges Skøyteforbund Styrke-, spenst-, hurtighets- og utholdenhetstrening Muskelarbeid Norges Skøyteforbund Trener I 2 Utvikling av kraft Utvikling av kraft kan skje når muskelen forkortes, holder en stilling

Detaljer

Norges Skøyteforbund. Styrke-, spenst-, hurtighets- og utholdenhetstrening

Norges Skøyteforbund. Styrke-, spenst-, hurtighets- og utholdenhetstrening Norges Skøyteforbund Styrke-, spenst-, hurtighets- og utholdenhetstrening Muskelarbeid Utvikling av kraft Utvikling av kraft kan skje når muskelen forkortes, holder en stilling eller forlenges Kraften

Detaljer

Trening og treningsprinsipper. Kristian Hoel Kongsberg, 13. november 2016

Trening og treningsprinsipper. Kristian Hoel Kongsberg, 13. november 2016 Trening og treningsprinsipper Kristian Hoel Kongsberg, 13. november 2016 Generell utvikling i fotball - Spillet går raskere - Spillerne er bedre trent - Mer penger i fotballen / viktigere å vinne - Større

Detaljer

MED SUUNTO FITNESS SOLUTION

MED SUUNTO FITNESS SOLUTION _1 MED SUUNTO FITNESS SOLUTION MEDLEMSVEILEDNING Suunto Fitness Solution _3 KOM I GANG! Suunto Fitness Solution er en ny måte du kan få mer ut av treningen på. Systemet registrerer aktivitetene dine, gir

Detaljer

Den daglige treningen er en evig balansegang mellom belastning, både b

Den daglige treningen er en evig balansegang mellom belastning, både b Treningsplanlegging Den daglige treningen er en evig balansegang mellom belastning, både b variert og spesifikt, og hvile. Utsagn som; trening er nedbrytende, det er under hvilen du blir bedre,, og skal

Detaljer

11. Studiet er gjennomført både kvantitativt med akselerometermålinger og kvalitativt gjennom observasjoner.

11. Studiet er gjennomført både kvantitativt med akselerometermålinger og kvalitativt gjennom observasjoner. Forord Denne masteroppgaven er skrevet ved Institutt for sosiologi og statsvitenskap ved NTNU i Trondheim. Utgangspunktet for valg av oppgave er en glødende interesse for fotball, både som faglærer på

Detaljer

Talentutvikling i juniorlangrenn for herrer

Talentutvikling i juniorlangrenn for herrer Talentutvikling i juniorlangrenn for herrer En treårig analyse av treningsutviklingen til en mannlig juniorløper i langrenn, sett i lys av; signifikante andres betydning, motivasjonelle faktorer og rammevilkår

Detaljer

Effekten av 20 ukers løpstrening på utrente.

Effekten av 20 ukers løpstrening på utrente. Effekten av 20 ukers løpstrening på utrente. «Sprek 3» - en intervensjonsstudie. av Iselin Brandal Berge Masteroppgave i undervisningsvitenskap idrett/kroppsøving Det humanistiske fakultet 2015 DET HUMANISTISKE

Detaljer

Midt på den ene langsiden skal brystkassen berøre underlaget. Forlengs eller sidelengs rulle er ikke tillatt

Midt på den ene langsiden skal brystkassen berøre underlaget. Forlengs eller sidelengs rulle er ikke tillatt Kondisjonstest - løp Løp i gymsal rundt markører med en varighet på 6 minutter. Det løpes i en rektangelformet bane på 44m, langsider er 15m og kortsider er 7m. To hindringer pr runde Midt på den ene langsiden

Detaljer

Forskning i idrett. Skal fotballspillere trene utholdenhet som kondisjonsutøvere? Fotballspillere og kondisjonsutøvere

Forskning i idrett. Skal fotballspillere trene utholdenhet som kondisjonsutøvere? Fotballspillere og kondisjonsutøvere Skal fotballspillere trene utholdenhet som kondisjonsutøvere? Olympiatoppen Nord-Norge Trenerens utfordringer Trenerseminar 10. juni 2011 Forskning i idrett Kunnskap fra forskning er nødvendig, men ikke

Detaljer

Idrett og energiomsetning

Idrett og energiomsetning 1 Medisin stadium IA, Tonje S. Steigedal 2 ATP er den eneste forbindelsen som kan drive kontraksjon av musklene. ATPnivået i muskelcellene er imidlertid begrenset, og må etterfylles kontinuerlig. Ved ulike

Detaljer

Vår filosofi hovedpunkt

Vår filosofi hovedpunkt Lederskapsfilosofi uansett virksomhet Vår filosofi hovedpunkt 1. Vær deg selv og gå foran som et godt eksempel, men samtidig vær ydmyk og villig til å utvikle og forandre deg. 2. Komponer og jobb i komplementære

Detaljer

Kompendium i Langrenn v/tor Oskar Thomassen Høgskolen i Finnmark

Kompendium i Langrenn v/tor Oskar Thomassen Høgskolen i Finnmark www.hifm.no Kompendium i Langrenn v/tor Oskar Thomassen Høgskolen i Finnmark * Arbeidskrav * Treningsplanlegging * Intensitetsstyring * Testing * Teknikk * Mental trening * Trenerrolle Finn Hågen Krogh.

Detaljer

Trening som behandling

Trening som behandling Aktiv satsing på fysisk aktivitet i forhold til pasienter med psykoselidelser: - Hva er mulig? Erfaringer fra St.Olavs Hospital Trening som behandling Jørn Heggelund St. Olavs Hospital, Trondheim. 1 2

Detaljer

Rehabiliteringstilbud til personer med kronisk utmattelsessyndrom (CFS) og Myalgisk encefalomyelitt (ME)

Rehabiliteringstilbud til personer med kronisk utmattelsessyndrom (CFS) og Myalgisk encefalomyelitt (ME) Rehabiliteringstilbud til personer med kronisk utmattelsessyndrom (CFS) og Myalgisk encefalomyelitt (ME) Ragna I. Gjone Anika Aakerøy Jordbru Øyunn Vågslid Lindheim Kysthospitalet Klinikk fysikalsk medisin

Detaljer

Fysisk trening/basistrening for unge fotballspillere

Fysisk trening/basistrening for unge fotballspillere Fysisk trening/basistrening for unge fotballspillere 28 år gamle Ronaldo trener halvannen time med Real Madrid hver dag, men det er ikke nok. - halvtime med eksplosiv sprinttrening, - time i klubbens styrkerom.

Detaljer

Treningsprogram for OSI Friidrett 2. november - 31. desember

Treningsprogram for OSI Friidrett 2. november - 31. desember Treningsprogram for OSI Friidrett 2. november - 31. desember Uke 45 (2. november - 8. november): : 30x45s p 15s jogg. : Jeg ser det litt an hvem som er på trening. Kort pause. Kondisjon type Grete Waitz.

Detaljer