Skriftlig oppgave Trener III Stein Arve Lone SKRIFTLIG OPPGAVE TRENER III D KURS Stein Arve Lone

Størrelse: px
Begynne med side:

Download "Skriftlig oppgave Trener III 2009-10 Stein Arve Lone SKRIFTLIG OPPGAVE TRENER III D KURS 2009-2010. Stein Arve Lone"

Transkript

1 SKRIFTLIG OPPGAVE TRENER III D KURS AV

2 Forord Jegharoverlengretidværtinteressertifysisktreningiforholdtilfotball.Selvomjegikke harhattnoenspesiellkompetansepåområdet,harjegmerketatinteressenforemnet harvokstsærligetteratjegharkommetinniettoppidrettsmiljøiolympiatoppenvest Norge.VedsidenavåværespillerutvikleriLøv HamFotballjobberjegsomspillerutvikler vedtoppidrettslinjeibergen.møtetmedinstruktørerogutøverefraflereulikeidretter harstimulertnysgjerrighetoginteressehosmeg. JegbestemtemegtidligforatjegvilleskrivemintrenerIII oppgaveinnmot fotballspesifikkfysisktrening.ettermangeforslagogideerklartejegåkommefremtilen problemstillingsompassettiltemaetjegønsketåjobbemed.davartidenkommetforå setteoppendisposisjonovermål,aktuelleteorier,oppbygningavundersøkelser,og drøftingsinnhold.minteoridelbyggerpåulikfaglitteratur.resultater,drøftingerog konklusjonerknyttettilempiripådetteområdetgjørdetsamme,ogitilleggpåendel egneerfaringer.ågjennomføremetodiskundersøkelsevarspennende,ogjegoppdaget atikkeallesvarenevarslikvihaddeforventet. Målet med teoridelen (2) er å skape en teoretisk og metodisk referanseramme for det videre arbeidet. Det er sett på grunnleggende teoretiske og forskningsmetodiske momenter.dettevilutgjøreutgangspunktetfordepåfølgendeempiriskedelprosjektene. Jeg vil særlig takke Geir Håvard Hjelde i Rosenborg, Patrik Hansson i SK Brann, Åge Skjeldestad (Løv Ham) og Roger Gjelsvik (Olympiatoppen) for god støtte underveis i arbeidet. I tillegg har jeg hele tiden visst at veileder Odd Einar Fossum ville kunne stille oppomjegskullehabehovforhansstøtteiarbeidet. Forfatteren 2

3 Sammendragavoppgave Tittel: Intensitetsstyringsomsuksessfaktor. Forfatter: SteinArveLone Bakgrunn Bakgrunnenfordenneoppgavenermininteresseoglysttilålæremerom fotballspesifikkfysisktrening.jegharoverlengretidværtinteressertifysisktreningi forholdtilfotball.jegharikkehattnoensærskiltkompetansepåområdet,menerselv innesominstruktøriettoppidrettsmiljøiolympiatoppenvestnorge.vedsidenavåvære spillerutvikleriløv HamFotballjobberjegsomspillerutviklervedToppidrettslinjei Bergen.Møtetmedinstruktørerogutøverefraflereulikeidretterharstimulert nysgjerrighetoginteressehosmeg. JegbestemtemegtidligforatjegvilleskrivemintrenerIII oppgaveinnmot fotballspesifikkfysisktrening.ettermangeforslagogideerklartejegåkommefremtilen problemstillingsompassettiltemaetjegønsketåjobbemed. Problemstilling Idenneoppgavensetterjegfokuspåhvordandettrenesfotballspesifiktfysisk. Hovedproblemstillingenerogsåutformetmedbakgrunnidettearbeidet; Hvordanbørvitrenefysiskpåenfotballspesifikkmåte? Underproblemstillingenemineeridennesammenhengenavhjelpendefaktorforatjeg harholdtfokusgjennomoppgaven; o Hvordantrenesdetgenereltfysiskpåenfotballspesifikkmåte? 3

4 o Hvordanvilulikeendringeritreningssituasjonensforutsetningerskapeendringiden fysiskepåvirkningen? Disseproblemstillingerharværtbåderetningsgivendeforoppgavensdreining,bådei forholdtilteoretiskreferanseramme,ogmetodiskdel. Teoretiskforankring Foråfinnesvarpåproblemstillingen,harjegforankretoppgavenienteoriramme omkringfysisktrening.oppgavensteoridelbyggerpålitteraturjegharfåttinnspillpåfra flereulikehold. Defysiskearbeidskraveneifotballharståttsentralt,enpresentasjonavhvaintensitetog treningii sonerer,hvaenergiomsetninghandleromogdetsammemedrestitusjonsom erenviktigdelavgenerelltreningsplanleggingogkvalitet.jegstuderteogsåen undersøkelseomkringhøyintensitetstreningifotball. Metodedel Undersøkelsensomkrystallisertesegutformeg,bleåfinneuthvordanuliketoppklubber inorgetrenerfotballspesifiktfysisk.jeghaddekontaktmedfireulikeklubbmiljøerogfikk innblikkidereshverdagogukesyklusikonkurransesesong.jeggjennomførteuformelle, kvalitativeintervjuermeddefysisketrenerneidisseklubbene.dettesammenlignetjeg medegneundersøkelserogegenukesyklusiløv HamFotball.Videregjennomførtejeg kvalitativeundersøkelseromkringhvordanendringavforutsetningerkunneendreden fysiskepåvirkningenitrening.jegvarnødttilåvelgeenmetodisktilnærmingsompåden enesidenkunnegietstørstmuligutbytteiforholdtilintensjonen,ogsomsamtidiglot seggjennomføremeddemidlerogdemulighetersomharståtttilrådighet. Altialtvurdererjegdenneundersøkelsensvaliditetsomtilfredsstillende,noejegogså finnerundersøkelsensreliabilitet. 4

5 Oppsummerendedrøfting/diskusjon Mindiskusjonomkringhvordanvikantrenebestfysiskbaserersegpådeundersøkelsene jegforetok,ogsamtidigdenteorisomharlagtibunniminoppgave.jegsåulike utfordringermedukesyklusenitoppfotballen,innslagavtreningii soneroghvordanvi kanskapeenvidereutviklingforåjobbebedrepådettefeltet.jegharværtopptattavå finnevariablerforåblibedrepååtrenebedre. Avslutningogkonklusjon Jegkonkludereridenneoppgavenmedatvi børistørregradøkevårbevissthetiøvelsesutvalget.påvirkervidetsomvi faktiskønskeråpåvirke? måværemerbevisstepåhvordancoachingepåvirkerintensitet.denkanøkes foreksempelfrai sone2tili sone4barevedenkleinstrukser. blimerbevisstepååtrenelavtnårvimeneråtrenelavt.påsammemåtei motsattfall,dersomvårintensjoneråtrenemedhøyintensitet.begynnervien øktpåfeilnivå,erdetvanskeligåkorrigereiløpetavøkten. måfåstørreinnslagavlavintensitetstreningforåbyggeetstørrevolum.med detkanvitåleåspissetreningenendamer. kanmedfordelblimerbevisstepåatbanestørrelse,ferdigheteneilaget,og antallspillerepåvirkerdenfysiskebelastningen børogsågåmeriretningav7:7og8:8istedetfor3:3og4:4.detteforågjøre intensivtspillmerfotballspesifiktogmindrebelastende. somjobberitoppklubbermåbliflinkeretilåutnyttedeteknologiske ressurseneogdenregistrerteinformasjonenvibesittter.dakanviutvikleden fysisketreningenytterligere. 5

6 Amancanseldom very,very,seldom fightawinningfight againsthistraining;theoddsaretooheavy. MarkTwain( ) 6

7 INNHOLDSFORTEGNELSE FORORD... 2 SAMMENDRAGAVOPPGAVE... 3 INNHOLDSFORTEGNELSE INNLEDNING PRESENTASJONPROBLEMSTILLING(ER) BEGREPSAVKLARING Aerobkapasitet Anaerobterskel Arbeidsøkonomi Belastningsfaktorer Energiomsetning(energiprosesser) Intensitet Intensitetssone Kvalitet Maksimaltoksygenopptak(VO 2maks ) Muskelensarbeidsmåter Overkompensasjon Supereksponering Treningsbelastning Utholdenhet Spesifisitetsprinsippet Variasjonsprinsippet Mennesketerenhelhetogreagererhelhetlig Progresjonsprinsippet Blokkprinsippet OPPGAVENSOPPBYGGING TEORIDEL INTENSITETSSONER TreningiI sone TreningiI sone TreningiI sone TreningiI sone TreningiI sone TreningiI sonene6,7og FYSISKEARBEIDSKRAVIFOTBALL ENERGIOMSETNING RESTITUSJON Restitusjonstiltak FRASTUDIEN HIGH INTENSITYTRAININGINFOOTBALLPLAYERS METODEOGGJENNOMFØRING METODOLOGIENSDESIGNOGUTFORMING Kvalitativtogkvantitativt Kvalitativeintervjuer

8 3.1.2Kvalitativeundersøkelser VURDERINGAVUNDERSØKELSENSKVALITET METODOLOGISKESVAKHETER UNDERSØKELSESRESULTATER PRESENTASJONAVINTERVJUER PRESENTASJONAVUNDERSØKELSER DRØFTINGSDEL AVSLUTNINGOGKONKLUSJON...53 ETTERORD REFLEKSJONOVEREGETARBEID LITTERATURLISTE

9 BildetillustrererHFbelastningiløpetavenkamp 1.0 INNLEDNING Idenneoppgavenharjegvalgtåskriveomfysisktrening.Deterfleregrunnertildette. Hovedgrunneneratjegsynesdetteerdetfagområdederjegharlavestkompetanse.Jeg haralltidsettpåmegselvsomennnysgjerrigogvitebegjærligtrener.jegharreistog besøktklubberinorge,frankrike,italia,england,belgiaforåstyrkekompetansen.men jegharalltidfordypetmegidetjegharværtmestinteressertiogmestopptattav.jeg haralltidværtmestopptattavreneogrelasjonellefotballferdigheteride25årenejeghar værtfotballtrener.desisteåreneharjegjobbetsomspillerutviklerpåheltidpå ToppidrettsgymnasetiÅsaneogiLøv HamFotballiBergen.Derjobberjegmedunge spilleresomnærmestovernattengårfrafemtiltolvukentligetreningsøkter.fysisk treningerensærdelesviktigdelavdethelhetligetreningsoppleggetforslikespillere.feil påvirkningidennefasenavenspillerskarriere,kanværefullstendigødeleggende.derfor harjegbestemtmegforåstyrkekompetansenminpådettefeltet. Enannengrunntilatjegvilgjøredettegrundig,eratjegharopplevdmangelpå konsensusifotball ogtoppidrettsmiljøet.detfinnesfagmiljøerogautoriteterpådette 9

10 områdetsomstårsteiltmothverandre.somlitefagligutrustet,harjegikkehattnoen somhelstselvstendigvurderingsevneavdeulikeoppfatningene. Jegharmåttetsynse,sitere,imitereellerstoleblindtpåandre tildelsmotsetningsfylte læringskilder. Jegharikketattmålavmegåfinnedenfulleogenestefasiten,menjegønskeråtrenge innimaterialetogdannemegminedokumenterbareoppfatningeromhvordanenbest muligbørtilretteleggedenfysisketreningenforåoppnåutvikling.jegharønsketåbli merbevisstpåsammenhengmellommålogmidler,ogharatdetteskalværebasertpå vitenskap. Jegsynesogsådetharværtmotiverendeåkunnesettedenfysisketreningeninnen toppfotballeninnietstørreperspektiv,foråbedrekunnetastillingtilhvasomermyter oghvasomersannheteromfotballsomtoppidrett. Etsistemomentsomharmotivertmegtilåtafattpådenneoppgaven,erenpåfallende likformutviklingilagetjegharværtmedåtrenedesistefireårene Løv HamFotball.De sistefireåreneharlagetvårttattpåfallendefærrepoengomhøstenenniløpetav vårsesongen.jegtrorikkedetteertilfeldig,ogharlysttilåforbedredenfysiske treningenvårforatdetteikkeskalskjeifortsettelsen. 1.2 Presentasjonproblemstilling(er) Hovedproblemstillingenidenneoppgavener: Hvordanbørvitrenefysiskpåenfotballspesifikkmåte? Denneproblemstillingenerbreiogfavneroversværtmye.Jegharværtbevisstpådette ogsettfarenveddet.mensomjegbeskriverinnledningsvisharjeghattetønskeomå læremestmuliginnenforetproblemfeltjegikkeharhattnokkunnskappå.noen 10

11 underproblemstillingererlikefulltsentraleformeg,ogværtennaturligdelavdetåfinne svarpåhovedproblemstillingen: o Hvordantrenesdetgenereltfysiskpåenfotballspesifikkmåte? o Hvordanvilulikeendringeritreningssituasjonensforutsetningerskapeendringiden fysiskepåvirkningen? 1.4 Begrepsavklaring Heravklaresendelsentralebegrepersomblirnyttetidennebesvarelsen Aerobkapasitet Aerobkapasiteterdentotaleaerobeenergiomsetningen(oksygenopptaket)iløpetaven definerttidsperiode.denkanogsåoppgissomgjennomsnittligoksygenopptakiløpetav dendefinertetidsperioden Anaerobterskel Anaerobterskelerdenhøyesteintensiteten(meterpersekund,watt)ienbestemt aktivitetsformderutøverharlikevektmellomproduksjonogeliminasjonavlaktat Arbeidsøkonomi Arbeidsøkonomieretmålpåhvormyeenergienutøverforbrukervedenbestemtfart ellerenbestemttilbakelagtdistanse.arbeidsøkonomienvedaerobtarbeider oksygenopptaketvedenbestemtfartelleroksygenopptaketprdistanseellerveden bestemttilbakelagtdistanse.teknikkerenviktigfaktorforarbeidsøkonomien Belastningsfaktorer Belastningsfaktoreneerintensitet,varighet,metode,aktivitetsform,underlag,sprint, antallsprintogpauselengde,værforholdoggeografiskeforhold Energiomsetning(energiprosesser) Prosesserimuskelfibrenesomomsetterenergi: 11

12 Kreatinfosfatprosessen(alaktasid) Anaerobomsetningavkarbohydrater(laktasid) Aerobomsetningavkarbohydrater Aerobomsetningavfett Intensitet Intensitetenerknyttettildenfysiskeinnsatsenienøvelse,aktivitetellerkamp. Hjertefrekvens oglaktatmålingergiretobjektivtbildeavdenindreintensiteten.farter etobjektivmålfordenytreintensiteten Intensitetssone Treningendelesinni8intensitetssoner.Inndelingenerforetattpåbakgrunnavhvordan ATP(energi)gjenoppbygges,oghvasomerhensiktenmedtreningsøkten Kvalitet Kvalitetinnebærerattreningengjennomføresetterhensikten.Begrepeterikkeidentisk medintensitet! Maksimaltoksygenopptak(VO 2maks ) VO 2maks erdenstørstemengdenoksygenkroppenkantaoppperminutt.detmaksimale O 2 opptaketuttrykkesiliterperminutt,milliliterperkilogramkroppsvektperminutteller medenfaktorforkroppsvektsomsamsvarerbedremedprestasjonen(milliliterper kilogramkroppsvektperminuttellermillimeterperkilogramkroppsvektperkilometer). OlympiatoppendefinererVO 2maks somgjennomsnittetavdehøyestevo 2 målingeneover ettminutt.detkanværestoreforskjellerivo 2maks forsammeutøveriulike aktivitetsformer,ogderforskalaktivitetsformenoppgissammenmedvo 2maks Muskelensarbeidsmåter Enmuskelkan Forkortes(konsentriskmuskelaktivitet) Strekkes(eksentriskmuskelaktivitet) 12

13 Arbeidesomenfjær(kombinasjonaveksentriskogkonsentrisk,dvsplyometrisk muskelaktivitet) Holde(isometriskmuskelaktivitet) Overkompensasjon Overkompensasjoneretresultataventreningsbelastningmedetterfølgendegod restitusjon,somførertilethøyereprestasjonsnivåennutgangspunktet Supereksponering Supereksponeringerenekstrastortreningsbelastningienøkt,dag,uke,enhelellerdeler aventreningsperiode.supereksponeringførertilenplanlagtoverbelastningavkroppen. Denmåetterfølgesavenlangnokrestitusjonsfase,oggirdaensuperkompensasjon Treningsbelastning Treningsbelastningenersummenavallebelastningsfaktorersompåvirkerspillerenunder entreningsøkt.treningsvarighet(treningstid)ogtreningsintensiteterdetoviktigste belastingsfaktorer Utholdenhet Utholdenhet(aeroboganaerob)erkroppensevnetilåmotståtretthet.Denaerobe utholdenhetharbetydningforresultatetialleidrettskonkurransersomvarerlengreenn 1 2minutter Spesifisitetsprinsippet Ispesifikktreningerbelastningsfaktoreneintensitet,varighet,aktivitetsform,underlag ogutstyrsålikforholdeneienkonkurransesommulig.hvorstordelavtreningensom børværespesifikk,varierermedkraveneidenaktuelleidretten,utøverenskapasitetog tidspunktetisesongen. 13

14 Etmålmeddenlangsiktigetreningeneratutøverenskalkunnetrenemer(fleretimer ellerlengredistanse)ikonkurranseteknikkenog intensiteten.ogsåiløpetavensesong viltreningengradvisblimerspesifikk Variasjonsprinsippet Variasjonenitreningsprosessenerviktigbådeavfysiskeogmentaleårsaker.Variert treningermerutfordreneogmindrekjedelig.variasjonenmotvirkerensidige belastningerogerdermedskadeforebyggende.detforhindrerstagnasjon,fordikroppen etterentidhartilpassetsegbelastningen.foråoptimalisereenårssykluserdetviktigå varieretreningsintensiteten,treningsvarighetenogaktivitetsformeneplanmessig. Variasjoneniorganiseringenavtreningenkanogsåøketrivselen. Prinsippetomindividuelloghelhetligstimulering Prinsippetomindividuelloghelhetligstimuleringinnebærerattreningenmåtilpassesdet enkelteindivid,samtidigsomdenutviklerhelemennesket Mennesketerenhelhetogreagererhelhetlig Selvomviiteorienforetarenoppdelingavutøverensferdigheterogegenskaper,måvi haklartforossathelhetenalltidermerennsummenavdelene.utøverenmåstimuleres helhetlig.derforbørfysiskeegenskaper,mentaleegenskaperogtekniskeferdigheter trenesparallelt,bådeihverenkelttreningsøktogoverenlengretidsperiode. Treningenmåtilpasseshvertenkeltindivid Deterstoreindividuelleforskjellernårdetgjelderhvormyetreningutøveretåler.Forat alleskalfåenoptimalprestasjonsutvikling,måtreningentilpasseshvertenkeltindivid,på bakgrunnavhvordanutøverenrespondererpåuliketypertrening.forskjelleri reaksjonsmønstrenekanskyldesarveligefaktorer,ellerdetkanværeavhengigav treningsbakgrunnen.derforkandensammetreningenhaforskjelligvirkningpåulike utøvere.detergrunnentilatalletreningsplanermåtilpassesindividuelt.enforutsening fordeteratplanenbyggerpåutøverenskapasitetsanalyseogtidligeregjennomført 14

15 trening.deterførstogfremsttreningsintensitetenogtreningsvarighetensomheletiden måtilpassesindividuelt Progresjonsprinsippet Progresjonsprinsippetinnebærerengradvisogsystematiskøkningavdeviktigste belastningsfaktoreneitreningen.belastningsskaderskyldesofteforstorprogresjon(for mye,forraskt,forofte).engradvisøkningavdentotaletreningsbelastningenog systematiskvariasjonavbelastningsfaktorene,forebyggerskaderogsykdom.deter viktigåfølgeprogresjonsprinsippetistartenavettreningsår,ogettersykdomog skadeperioder.idisseperiodeneerutøverneoftesværttreningsivrige. Treningsmotivasjonenmåaltsådempes,slikatøkningenitreningsbelastningenikkeskjer forraskt. Enfornuftigtreningsprogresjongjelderikkebarefortreningsvarighetog treningsintensitet,menogsåforandrebelastningsfaktorer.ifotballerdetviktigmed skotøyogskifteavunderlag.engradvisbelastningsøkningerogsåenforutsetningforå forbedreprestasjonsevnenkontinuerlig.progresjonenitreningenmåskjeiløpetav sesongenogfraårtilårnårdetgjelder Dentotaletreningsbelastningen Treningsintensiteten Treningsvarigheten Treningshyppigheten Aktivitetsformen Underlaget Erfaringenviseratnårtreningsbelastningenskaløke,erdethensiktsmessigåøkeantall treningsøkterførst,deretterøkevarighetenavtreningsøkteneogsåtilsluttøke varighetenpåtreningensomgjennomføresii sonene3,4og5.etterhvertkandetogså væreaktueltåerstattenoenavøkteneii sonene3eller4medøkterii sonene4eller5. 15

16 Blokkprinsippet Blokkprinsippetinnebæreratulikeformerfortreningvektleggesuliktideforskjellige treningsperiodeneienårssyklus.bakgrunnenformodelleneratforskningogerfaringhar vistatmyestyrketreningharennegativinnvirkningpåteknikkoghurtighetstreningennår beggetreningsformenebrukesisammetidsperiode(werchoshanski1988).samtiderdet myesomtyderpåatstyrketreningenblirmereffektivdersomdengjennomføresi blokker. Itilleggvisererfaringatdetikkeermuligåtreneallefysiskeegenskaperpåsammetid. Derformåtreningentilretteleggesslikatnoenutvalgteegenskaperutviklesiendefinert tidsperiode,mensandreegenskaperbarevedlikeholdes.detgjelderikkebareforholdet mellomstyrketreningogutholdenhetstrening,menogsåforulikeegenskaperi utholdenhetstreningen. Figur1 Ipraksiskanblokkprinsippetgjennomføresvedådelesesongeninnitreningsperioder medunderperioder,dernoenutvalgteegenskaperutvikles,mensandrebare vedlikeholdes.inndelingenmåplanleggessystematiskforåoppnåenoptimal 16

17 prestasjonsutvikling.varighetenavdeulikeblokkenekanvarigerefra1til12uker. Hensiktenbestemmervarighetenpåtreningsperioden. 1.5 Oppgavensoppbygging Kapittel1erviettilinnledningogbeskrivelseavoppgaven.Såfortsetterjegmedå Skriftlig oppgave presentereendelteoretiskgrunnlagsstoffmedhenblikkpåfysisktrening(kapittel2),før jegvierkapittel3tilåbeskrivemetodologienioppgaven,samtatjegviderepresenterer resultatenefraforskningsarbeidetikapittel4.metodologiogresultaterdrøftesikapittel 5oppmotoppgavensteori.Konklusjonerfattesikapittel TEORIDEL Idetfølgendepresenteresrelevantteoriomkringemnetfysisktreningogfotball. 2.1 Intensitetssoner Treningsbelastningeretsamlebegrepfordenpåvirkningenkroppenutsettesfori treningsarbeidet.denmåtilpassesutøverenståleevne.samsvaretmellom treningsbelastningogtåleevnebestemmerhvorrasktoghvormyeprestasjonsevnen forbedres. Utformingenavtreningsøktenmåtautgangspunktihensiktenmedtreningen.Deter sammensetningenavbelastningsfaktorenesomavgjørtypenogstørrelsenpå treningsbelastningen.ifotballertreningsintensiteten,treningsvarigheten, aktivitetsformen,lengdenpåtreningenogpauserdeviktigstebelastningsfaktorene. 17

18 Figur2 Foratviskalkunneplanlegge,gjennomføre,dokumentereoganalysere utholdenhetstrening,mådendelesinniintensitetssoner.olympiatoppenhar,isamarbeid medfagpersonellfranorgesidrettshøgskole,definert8intensitetssoner.inndelingener foretattpåbakgrunnavhvordanatpgjennombyggesoghvasomerhovedhensikten medtreningsøkten.tabell(under)girenoversiktoverolympiatoppensåttedelte intensitetsskala,medveiledendeverdierfor%avvo 2maks, maksimalhjertefrekvens(hf maks),laktatverdierogeffektivvarighetforhverenkeltintensitetssone. Feedbackfrahjertefrekvens(pulsbelte) oglaktatmålingerundertreningogtesting forbedrerutøverensintensitetsfølelse.dissemålingeneerderforviktigehjelpemidlerfor åstyretreningenslikatdenblirgjennomførtsomplanlagt. 18

19 OlympiatoppensI soneinndeling Fig3 I-sone 8 I-sone 7 I-sone 6 I-sone 5 I-sone 4 I-sone 3 I-sone 2 I-sone 1 % av VO2 % av H Laktat(Lactate Effektiv maks maks Pro) varighet min min min ,0-10, min ,0-6, min ,5-4, min ,5-2,5 1-3 timer ,8-1,5 1-6 timer TreningiI sonene1 5påvirkerihovedsakdeaerobeenergiprosessene.Treningi intensitetssonene6,7og8påvirkerhovedsakeligdeanaerobeenergiprosessene. Hensiktenmeddenaerobeutholdenhetstreningeneråutvikledenaerobekapasitetenog arbeidsøkonomien.detskjergjennomenforbedringavkapasitetenihveravde5aerobe intensitetssonene.kapasitetenkanforbedresvedatutøverenkan Holdehøyerefartvedsammepuls Arbeidelengermedsammepuls TreningiI sone1 HovedmåletmedtreningiI sone1eråforbedredenaerobekapasitetenog arbeidsøkonomien.vedtreningii sone1forbedresaerobkapasitethovedsakeligvedat utnyttelsesgradenblirbedresomfølgeavatdelokaleforholdeneiogrundt muskelfibreneforbedres.iintensitetssone1erdetaerobenergiomsetning,medca %omsetningavfettogca.60 40%omsetningavkarbohydrater.Deterbalansemellom tilførselogbehovforoksygenienergiomsetningen.dermederdetlikevektmellom produksjonogeliminasjonavlaktat(laktatlikevekt). 19

20 Treningstideniintensitetssone1erlang(éntiltotimer).TreningiI sone1omfatterogså restitusjonstrening.denharsomhensiktågjenopprettehomeostasenogbyggeopp karbohydratlagreneetterkamp.davilutøverpresterebedreinesteøkt.i restitusjonstreningvarierertreningstidenideflestetilfellermellom45og60minutter,og treningengjennomføressomkontinuerligarbeid TreningiI sone2 HovedmåletiI sone2eråforbedredenaerobekapasitetenogarbeidsøkonomien.ved treningii sone2forbedreskapasitetenhovedsakeligvedatutnyttelsesgradenblirbedre somfølgeavforbedretevnetilfettomsetning. Iintensitetssone2erdetaerobenergiomsetning,medca.50 80%karbohydraterogca %omsetningavfett.Deterbalansemellomtilgangogforbrukavoksygeni energiomsetningen.dermederdetlaktatlikevekt.treningii sone2kanderforhalang varighetførkarbohydratlagreneblirtømt.treningstideneiintensitetssone2børvære lang(éntiltotimer) TreningiI sone3 HovedmåletmedtreningiI sone3eråutvikledenaerobekapasitetengjennomen forbedringavutnyttelsesgraden,arbeidsøkonomienogvo 2maks. Detgirsegutslagi forbedretfartveddenanaerobeterskelen,altsåen høyreforskyvningavlaktatprofilen. Bedreaerobkapasitetogbedrearbeidsøkonomiforbedrerevnentilåarbeidelengreved denanaerobeterskelen.iintensitetssone3erdetaerobenergiomsetning,med80 90% omsetningavkarbohydraterog10 20%omsetningavfett.Deterbalansemellomtilgang ogforbrukavoksygenienergiomsetningen,altsåerdetfortsattlaktatlikevekt. Treningsøkteriintensitetssone3børgjennomføresmedspesifikkaktivitetsformogen 20

21 effektivvarighetpå40til60minutter.dersomhensiktenmedåvedlikeholdekapasiteten ii sone3kaneffektivvarighetreduserestil25 30minutter TreningiI sone4 HovedmåletmedtreningiI sone4eråutvikledenaerobekapasitetengjennomen forbedringavutnyttelsesgraden,arbeidsøkonomienogvo 2maks. Detgirsegutslagi forbedretfartveddenanaerobeterskelen,altsåen høyreforskyvningavlaktatprofilen. Iintensitetssone4erdetfortsattoverveiendeaerobenergiomsetning,med80 95% omsetningavkarbohydraterogca.5 10%omsetningavfett.Ca5 15%av energiomsetningenkommerfraanaerobelaktatsideprosesser,somomsetterrelativt storemengderkarbohydrater.denytreintensiteten(farten)ersåhøyatproduksjonenav laktaterstørreenneliminasjonen.vedkontinuerligebelastningervildetderforgradvis hopesegopplaktat.treningsøkteneiintensitetssone4hareneffektivvarighetpå25til 40minutter.DersomhensikteneråvedlikeholdekapasiteteniI sone4kaneffektiv varighetpåtreningsøktenreduserestil15 20minutter TreningiI sone5 HovedmåletmedtreningiI sone5eråutvikledenaerobekapasiteten.treningenvilogså tilenvissgradpåvirkedenanaerobekapasiteten(toleranseevnen). TreningiI sone5innebærerenintensitetpåellerlikeiunderkantavdetmaksimale oksygenopptaket.intensitetenertydeligoverdenanaerobeterskelen.derformå10 25% avenergienkommefraanaeroblaktsidenergiomsetning.varighetenpåøktenii sone5 erderforrelativkort.75til90%avenergienkommerfraaerobomsetningav karbohydrater.treningii sone5børnestenutenunntakgjennomføreskamplikt.den effektivevarighetenervanligvis15 25minutter,ogøktengjennomføressom intervallarbeidhvorpauseneerlittkortereennarbeidstid. 21

22 2.1.6 TreningiI sonene6,7og8 HovedmåletmediI sonene6,7og8eråutvikledenanaerobekapasitetenvedå forbedreevnentilåprodusereatppertidsenhetvedhjelpavdetanaerobelaktaside systemet.treningenvilogsåøketoleransenformelkesyre. Disse3soneneharliterelevansmedfotball. Innenforfotballensegenartvariererintensitetenmyeiløpetavenkamp.Derforvelger manengrovereinndelingavintensitetssonene.inndelingenerlav,moderat,sværthøy (setabellunder) Intensitetssoner brukt i fotball Figur4 Detviktigsteerattreningsprogrammeterøktermedforskjelligeintensiteter,ogat varigheteneravpassettilintensiteten.forengodttrentfotballspillerbørvarighetenpå innsatsenvedlavintensitetvære40 60minutter,vedmoderatintensitet20 40minutter, vedhøyintensitet10 20minutterogvedsværthøyintensitet2 5minutter (hurtighetstrening). 2.2 Fysiskearbeidskravifotball Fotballerensammensattidrett,somstillerkravtilmangeulikefaktorersomjogging, hopping,spurtingiminst90minutter.fotballspillerenmåværeallsidig,menifotballer detogsåmuligåkompensereforsvakheterpåettområdeogholdehøytnivåpåandre 22

23 områder.forskningharprøvdådefineredefysiskeutfordringersomfinnesifotball. Imidlertidvilfotballspilletskompleksitetgjøredetvanskeligådefinereandreabsolutte krav. Figur5 Etlagssamledefotballferdigheterersummenavdeenkeltespillernesfotballferdigheter ogitilleggtillagetsevnetilsamhandling.defysiskeressurseneskalgjørespillerenistand tilåutnyttefotballferdighetenesineikampsituasjonenoggjørelagetistandtilå gjennomføredettaktiskeoppleggetogderetningslinjeneforspilletmanerblittenigom. Påsammemåtemåspillerentahensyntilsinefysiskeressursernårhanellerhunskal utformeoggjennomførefotballferdighetenesine.nårmanskaltreneoppdefysiske ressursenemåmantautgangspunktifotballspilletogresultatetavtreningenmå bedømmesoppmothvilkeneffektdenharpåspillet. Enutespillertilbakeleggermellom8 13kmiløpetavenfotballkampogdeterliten variasjonbådemellomkjønnogmellomdeulikenivåene(disalvo2007,krustrup2005). Tilbakelagtdistanseerlikeveletgrovtmålpådefysiskekraveneunderenfotballkamp. 23

24 Deterfordimestepartenavforflyttingenskjervedgangeogjoggingmedlavintensitet. Over90%avtidenienfotballkampbenyttestilåstå,gåellerroligløping(setabell under).dentilbakelagtedistansenvariererogsåavhvilkenposisjonspillerenharpålaget. Midtbanespillereløperenlengredistanseennspillereiandreposisjoner,mens midtstoppereløpermindreennandre(disalvo2007,mohr2003).backer,kantspillereog angrepspilleresprintermerennmidtstoppereogmidtbanespillere(disalvo2007). Tidsbrukikampfordeltpåulikeintensiteter Verdieneergittiprosentavtotalkamptidogoppgissomgjennomsnitt(standardavvik)for mennoggjennomsnitt(variasjonsbredde)forkvinner.høyintensivløpinger>20km/time forkvinnerog>24km/timeformenn.internasjonaltnivåerlagsomspillereuropa cup, nasjonaltnivåertypisk2.divisjon.setabell1.2,fotnotefordefinisjonavsprint. Figur6 Detinteressanteeratbare1 2,5%avdentilbakelagtedistansengjøresmedball(DiSalvo 2007).Igjennomsnittgjørspillerneenaktivitetsendringhvertfjerdesekund,somtilsvarer nesten1500aktivitetsendringeriløpetavenkamp(krustrup2005).spillerepå internasjonaltnivå(toppklubberieuropa)løperaltsåikkenødvendigvisenlengre distanseennspillerepånasjonaltnivå,menandelensprinterbetydelighøyerehos spillerepåinternasjonaltnivå.ienundersøkelsefantmanatinternasjonaletoppspillere dekker28%størredistansehøyintensivløping(>24km/t)og58%størredistanseved sprining(>30km/t)ennspillerepålaverenivå.detskyldesførstogfremstatdegjørflere høyintensiveløpogikkeatdeløperlengrepr.løp(setabellunder).deterinteressantå merkesegatkvinnerpåinternasjonaltnivågjennomførerlikemangesprintersommenn pånasjonaltnivå(denhastighetensomerdefinertsomsprint,erforkvinner25km/tog formenn30km/t.fratalleneovenforkanviregneutatforhverthøyintensiveløppå2 4 sekunderergjennomsnittet20 40sekundermedroligaktivitet(stå,gåellerjogge). Mellomhvergangenfotballspillersprinter,erdetigjennomsnittover2minutterpå 24

25 internasjonaltnivåogover3minutterpånasjonaltnivå.studierharogsåvistatantall sprintereretsuksesskriteriumifotball.dentilbakelagtedistansenermindreiandre omgangenniførste,bådenårdetgjelderlavintensitetsløping,høyintensivløpingog sprinting(disalvo2007,mohr2003). Antallhøyintensiveløp,sprinter,taklingerogheadingeriløpetavenkamp Verdieneergjennomsnitt(standardavvik)formennoggjennomsnitt(variasjonsbredde)for kvinner.sprinter>25km/timeforkvinnerog>30km/timeformenn. Figur7 Figur8 25

26 FigurenovererfraNM4.runde2009mellomRosenborgogLøv HamFotball.Somman seravfigurenerdetmarginaleforskjelleriløpslengdenforrbkogløv Ham.Imidlertid hadderbk17%merhøyhastighet+sprint,mensforskjellenøkteendameriforholdtil sprinthvorrbkhadde38%merennløv Ham.Dettegjenspeilerteorien. 2.3 Energiomsetning Foråutføreetarbeidkrevesdetenergi.Energienkommerfrakarbohydrater,fettog proteinersomvitilførerkroppenframatogdrikke.ikroppenbyggesdetopplagreav fettogkarbohydrater.foratenergienimatenskalkunnebenyttesi muskelkontraksjoner,mådenomsettestilatp(adenosintrifosfat).detmesteav energiensomomsettes,kommerfrakarbohydraterogfett.karbohydratenesomdet finnesmestavikroppen,erglykogenogglukose.jegbrukerbetegnelsenkarbohydratog karbohydratlager.fettfinnessomfettsyrerogtriglyseridermenjegbrukerbare betegnelsenfett. Prosessenesomomsetterkjemiskenergi(fett,karbohydraterognoeprotein)tilATP kallesaeroboganaerobenergiomsetning.aerobenergiomsetningbenytterogså oksygen,mensanaerobenergiomsetningeruavhengigavoksygen. Energikanikkeoppståellerforsvinne.Derforbrukesbegrepetenergiomsetningogikke energiproduksjonomdenneprosessen.energiomsetningenersentralfor prestasjonsevnenogtreningsprosessen. Påsammemåtesomenbilmotorkanomsettedenkjemiskeenergienibensintilåskape drivkrafttilbilhjulene,kankroppenomsettedenkjemiskeenergienimatentilmekanisk arbeid(musklenebevegerknokleneslikatetarbeidblirutført).foratdenkjemiske energiensomfinnesikarbohydrater,fettogproteiner,skalkunnebenyttestilmekanisk arbeid,mådenkjemiskeenergienførstomsettestilatp. 26

27 Bare25%avenergieninæringsstoffenegårovertilmekaniskarbeid.Restenbliromsatttil varme.muskelfibrenesomskalutførearbeidet,brukerenergiensomfinnesiatp.veden muskelkontraksjonomsettesatptiladp(adenosindifosfat). ATP >ADP+P(fosfat)+energi DetfinnesbareenlitenmengdeATPimuskelfibrene,noktilnoenfåsekundersarbeid. ForåunngåatATPinnholdetfallerunderenvissgrensenårmuskelenskalskapekraft lengerenninoenfåsekunder,måadpmolekyletbyggesopptilatpigjen.denne gjenoppbyggingenkreverenergi.energiensomtrengsfårådannenyatpskaffer musklenesegvedåomsettekarbohydraterogfettellervedåoverføreenergienfra kreatinfosfat. ATPgjenoppbyggesvedhjelpav4prosesser.Påfigurenunderskalde4beholderne illustreredisseprosessene.ettersombidragetfraproteinienergiomsetningenerlite,er proteinutelattimodellen. Figur9 De4prosesseneforenergiomsetninger 27

28 Kreatinfosfatprosessen(alaktasid)(beholder1) Anaerobomsetningavkarbohydrater(laktasid)(beholder2) Aerobomsetningavkarbohydrater(beholder3) Aerobomsetningavfett(beholder4) Kreatinfosfatprosessen(beholder1)oganaerobomsetningavkarbohydrat(beholder2) skjerutenbrukavoksygen,ogprosesseneerforanaerobe.aerobomsetningav karbohydrater(beholder3)ogaerobomsetningavfett(beholder4)skjermedoksygen ogprosesseneerderforaerobe.energilagreneogenergimengdensomkanomsetteside 4prosesseneeravforskjelligstørrelse.Detersymbolisertvedulikestørrelserpåde4 beholderne.mengdenatpsomkanomsettesprtidsenhetsymboliseresveddiameterpå røreneutfrade4beholderne. Prosesseneforenergiomsetningarbeidersammenforåleveredennødvendige energimengdensombrukestilåbyggeoppigjenadptilatp.hvilkenprosesssomleverer mestenergiistorgradavhengigavarbeidetsintensitetogvarighet(sefigurunder),og hvilkemuskelfibertypersomeribruk.ogsåutøverensprestasjonsevne,størrelsenpå karbohydratlagrene,hvasomblespistognårinntaketavnæringskjedde,kanpåvirke hvilkenprosesssomgirmestenergi. Hvorlangtiddettarførkarbohydratlagreneertomme,erførstogfremstavhengigav intensitetenogvarighetenpåarbeidet,ogavstørrelsenpåkarbohydratlagrene.dessuten vilevnentiløktomsetningavfettutsettetømmingenavkarbohydratlagrene.vedtrening ii sone3(80 87%avVO 2maks )kommerca.80 90%avenergienfrakarbohydrater(se figurene1.7og1.8).engodttrentfotballspillerkantreneii sone3ica.90minutterfør karbohydratlagreneertilnærmettomme(figur1.6).treneii sone4(ca.87 94%av VO 2maks )viltømmekarbohydratlagreneetterca.60minutter.karbohydratlagrenevarer lengrejobedretrentmaner.detskyldesatdeharstørrekarbohydratlagre,ogatde forbrukermindrekarbohydratermenmerfettenndårligtrentepersonervedsamme intensitet.jobedretrentmanerjolengrekanmanøkevarighetenihverintensitetssone. 28

29 Deterviktigåfølgeoppkarbohydratlagreneettertreningvedåspisekarbohydrater.Det tar12 24timeråfølgeopptommekarbohydratlagre,avhengigavtypenæringog treningstilstand.sportsdrikkellerlettfordøyeligmatmedhøytkarbohydratinnholdbør inntasalleredeundernedjoggingellergjerneunderveisiaktiviteten,dersomdetermulig. Deterviktigattilførselenav1 1,5gramkarbohydraterperkilogramkroppsvektskjerraskt oghelstinnen30minutteretteravsluttetaktivitet.etterenhøyintensitetsøkterdet viktigåinnta10 20gramproteinitilleggtilkarbohydratene.Proteinstimulererbåde proteinsyntesenoglagringenavkarbohydrat. Dersomutøverenikkespisernokkarbohydraterundermåltidenemellomtreningsøktene, kandetovertidføretilkronisklavtkarbohydratnivå.deterikkemuligågjennomføre treningiintensitetssone3ellerhøyerepåenoptimalmåte.årsakeneratutøverengår tomforkarbohydratertidligiøkten,ogintensitetenmåreduseres,ellertreningsøktenmå avsluttes. Riktiginntakavnæringerderforenavgjørendefaktorforåkunnegjennomføretrening medhøyintensitet(intensitetssonene3 7). Treningsomsystematisktømmerkarbohydratlagrene,ogsystematiskoppfyllingmellom økteneføreretilatlagrenesstørrelseøker.detteerenviktigtreningseffekt. 2.4 Restitusjon Lengdenpårestitusjonstidenavgjørhvormyeoghvorofteutøverenkantrene.Deneri hovedsakavhengigavtreningsbelastningen,hvaslagsrestitusjonstiltakutøveren benytterfør,underogettertreningsøkten,ogutøverenstreningstilstand.ifølgebadtke (1987)restituererinternasjonaleutøveresegdobbeltsårasktsomutøveremeddårlig treningsgrunnlag.iaerobutholdenhetstreningoptimaliseresrestitusjonenved tilstrekkeligpåfyllavveskeognæring(brukeogdeeakin2000).erfaringviseratgod generellaerobkapasitetredusererrestitusjonstidenforalleidrettsutøvere. 29

30 Restitusjonstidenkanværeforskjelligfrautøvertilutøver,uavhengigav prestasjonsnivået.itileggpåvirkesrestitusjonstidenavhvilkefysiskeegenskaperog strukturersombelastes.dettarselvsagtkorteretidågjenoppretteveskebalansenenn ogbyggeoppkarbohydratlagene.dermedkannoenstrukturerværefullstendig restituert,mensandredelvisrestituert.denpraktiskeerfaringenmed2og3 treningsøkterperdag,viseratdetermuligogtreneførutøverenerfullstendigrestituert. VedogtreneiI sone1og/ellervariereaktivitetsformeneerdetmuligåstarteny treningsøktlengeførrestitusjonenerferdigfullstendig Restitusjonstiltak Foråkunnetrenemedstørrevarighetoghøyereintensitetmåmansetteinntiltaksom forkorterrestitusjonstiden.restitusjonstiltakenepåvirkerfysiologiske,psykologiskeog sosialefaktorer.restitusjonsmetodenemåvarierebådefør,underogetter treningsøkten,ogdeeristorgradavhengigavtreningensomergjennomført.for eksempelkannoentiltakværebedreegnetetterstyrketreningennetter utholdenhetstrening.nedenforbeskrivesnoensliketiltak.denmentaleogsosialesiden erselvsagtogsåviktigmenjeggårikkeinnpådether. Sørgforåhafullekarbohydratlagreførtreningogkamp Foråkunnepresteregodtikamperdetviktigoghavelfyltekarbohydratlagre.Deter ogsåenforutsetningforåkunneopprettholdeintensitetenlengenokii sone3 6.det sistemåltideførentreningsøktellerenkampmåtilførekroppenrikeligmed karbohydrater.tidspunktetforoginnholdeisistemåltidmåselvsagttilpasses totalbelastningen,ogdeindividuellebehov.måltidetbørinneholderikeligmedvann, melkfruktjuiceellersaftgenereltbørdetsistemåltidetinntas2 3timerføroppvarmingen starter.detsikreratblodsukkernivåetnormaliserersegførstart,ogdetforhindrer mageproblemerundertreningellerkamp.måltidetbørinneholdeca,55 60prosent energifrakarbohydrater,ca30energiprosentfraproteinerogca15energiprosentfra fett.vedlangetreningsøkterellerkamperkandetværehensiktsmessigåinntalitt karbohydrater foreksempelloff,bananellerenergibarca1timefrastart.itileggtil 30

31 næringsinntaketvilogsåhvile,lettfysiskaktivitetogmassasjekortened restitusjonstiden. Undertreningogkamp Opprettholdvæskebalansen,fyllpåmedkarbohydraterogværiaktivitetipausene. Væsketapetundertreningogkampvarierervanligvismellom0,5og2,0literpertime, avhengigavtreningstilstand,treningsintensitet,påkledningogværforhold.prestasjonsevnenreduseresmedca10%forhverprosenttaptkroppsvektpågrunnav væsketap.utøverenbørderfordrikke0,4 1,0literunderalltreningsomvarerimerenn 30minutter,uavhengigavintensitetogværforhold.Dersomdetersværtvarmteller fuktig,erdetbehovforbetydeligmervæske.væskeinntaketbegynnersenest15minutter etterstart,ogopprettholdesmedca.0,2 0,3literhvert20.minutt.Kald,drikke,menikke iskald,ervelegnetivarmtklima.ikaldtklimaerdetmerbehageligåbrukevarmere drikke.enutøverdrikkersannsynligvismerdersomdrikkenervelsmakende.utøverenmå selvfinneframtilriktigkonsentrasjonogtemperatur. Vanligvistrengerikkeutøverenåinntakarbohydraterdersomtreningeneller konkurransenerkortereenn60minutter.dersomkarbohydratlagreneikkeerfullenår aktivitetenstarter,kankarbohydratinntakfremmeprestasjonsevnenselvvedenslikkort belastningstid.redusertekarbonhydratlagreskyldessomregelforlavt karbohydratinntakgenerelt,ikombinasjonmedstortreningsbelastning.ved treningsøkterogkonkurranserover60minutterbørkarbohydratinntaketvære30 60 gramhvertime.dettilsvarerkarbonhydratinnholdetica5 10dlsportsdrikk. Karbohydratholdigdrikkeerbådepraktiskogenkeltoginnta,samtidigsomrisikoenfor mageproblemererliten.utøverenbørinntakarbohydrateralleredeiløpetavdeførste 30minutteneforatdetskalhaprestasjonsfremmedeeffekt,ogfortsettemeddethvert 15 20minutt.Eventuellepausermellomintervalldragellerkonkurranserbenyttestillett aktivitetoginntakavkarbohydraterogvæske. 31

32 Ettertreningogkonkurranser:spisogdrikkumiddelbart! Kostholdetharstorbetydningforrestitusjonsprosessene.Grunnentilattopp idrettsutøvereinntardrikkerettettermålpassering,eratdetsetterigang restitusjonsprosessenehurtig.slikerestitusjonsdrikkerinneholderrikeligmed karbohydrater,menogsåendelproteiner.dersomutøverenslurvermedinntakav restitusjonsdrikke,kanblantannetimmunforsvaretsvekkes,ogrisikoenforfeiltrening øker. Foråmålevæsketapetundertreningkanutøverenveiesegførogettertreningsøkten. Detgirenpekepinnpåhvorstortvæskeinntaketmåværeforågjenopprette væskeballansen.entommelfingerregelsieratvæskeinntaketbørvære150%av væsketapet.fordeflestetilsvarerdetetvæskeinntakpåminst5dlumiddelbartetter økten,ogderettermindremengderfordeltoverdenestetotimene,inntil væskeballansenergjenopprettet.utøverenersomregelivæskeballansenårurinener tilnærmetvannfarge. Forogsikreoptimalkarbohydratlagringskalutøvereninnta1 1,5gramkarbohydratper kilogramkroppvekstsværtraskt,senestiløpetavdenførstehalvtimenetteraktiviteten. Dissekarbohydratenebørværelettereåtaopp,ogdekankommefrabådedrikkeog mat.inntakavproteinrettettertreningerviktigfordidetstimulererbåde proteinsyntesen(reperasjonavmuskelvev)oglagringenavkarbohydrater.proteininntak hareffektførstogfremstvedtreningsøktermedstortotaltreningsbelastning,ogved styrketrening.utøverenbørinnta10 20gramproteiniformavdrikkeellermatsenest30 minutteretterallesliketreningsøkterogkonkurranser. 32

33 90-95% restitusjon 100% retitusjon Varighet av (ufullstendig) (fullstendig) overkompensasjonsfasen I-sone 1 fortløpende/ fortløpende eller opp til et par døgn noen timer opp til 36 timer I-sone timer timer 1-3 døgn I-sone 3 12 timer timer 2-4 døgn I-sone timer timer 3-5 døgn I-sone timer timer 3-6 døgn I-sone timer timer 3-6 døgn I-sone timer timer 3-6 døgn I-sone timer timer 3-6 døgn Figur10 restitusjonstid(frahallen2008:fysisktreningifotball) 2.5 Frastudien High intensitytraininginfootballplayers FrancoM.ImpellizzeriharIsindoktoravhandling High intensitytraininginfootball players effectsonphysicalandtechnicalperformance,gjennomførtenstudiehvorhan undersøktehvilkeneffektøvelsestype,banestørrelseogtrenerpåvirkninghaddepå intensitetogreproduserbarhetismåspill(imperllizzeri2009).datablesamletinnpå20 amatørspillere,medgjennomsnittsvekt73kg,gjennomsnittshøyde1,79mog gjennomsnittsalder24,5.populasjonsutvalgethaddegjennomsnittsvo2maxpå56,3. Studienefokusertepåspill3:3,4:4,5:5,6:6påtreulikebanestørrelsermedoguten trenerpåvirking(motiverendetilrop). Størrelser Spill Liten Middels Stor 3 mot 3 12 x 20 m 15 x 25 m 18 x 30 m 4 mot 4 16 x 24 m 20 x 30 m 24 x 36 m 5 mot 5 20 x 28 m 25 x 35 m 30 x 42 m 6 mot 6 24 x 32 m 30 x 40 m 36 x 48 m Figur11 33

34 Kamplengdenvar4minuttermed3minutteraktivpause.Detblespilt 4x4 kamper. Hjertefrekvens(HR), ratingofperceivedexertion (RPE)påCR10 skalaenogblodlaktat blemålt(rpe:subjektivtopplevdintensitet1 10). Figur12:Variasjonerav5:5og6:6. MålingenetilImpellizzerivisteatdetblehøyestintensitet,RPEogblodlaktatved3:3med storbanestørrelse.storforskjelliblodlaktaterverdtåmerkesegmedtankepå akkumuleringavlaktatiblodogmuskel.impellizzeribenytterlaktatterskelpå2.5 4mmol idennestudien,mensendelannenlitteraturogundersøkelservilbenytteandreverdier. Ved6:6varlaktatmålingen3,4mmolog6,5mmolved3:3.Dvsatdeved3:3har akkumulertsyreogfåttstivebeine.detteførtesannsynligvisdårligereprestasjonsevne. Ved coachencouragment visesdetenrelativtlitenøkningipuls(89,1til90,9%av maxhr),mentrenerenspåvirkninggirenrelativtstorendringilaktat(5 6,5mmol). Detteertallfrastorbane3:3. KonklusjoneniImpellizzerisstudie,viseratågjøreendringeribanestørrelse,øvelsestype (3:3vs6:6)ogtrenerfeedback,kanintensitetenpåvirkes(sefigur). 34

35 Hjertefrekvens (% av maksimal) Belastning i soner Spill Størrelse m/coatching u/coatching m/coatching u/coatching 3 mot 3 liten 89,5 87,6 6 4,4 middels 90,5 88,6 6,3 4,6 stor 90,9 89,1 6,5 5 4 mot 4 liten 88,7 86,5 5,3 4,2 middels 89,4 86,7 5,5 4,3 stor 89,7 87,2 6 4,7 5 mot 5 liten 87,8 86 5,2 3,9 middels 88,8 86,1 5 4,1 stor 88,8 86,9 5,8 4,6 6 mot 6 liten 86,4 83,8 4,5 3,4 middels 87 85,1 5 3,9 stor 86,9 85 4,8 3,6 Figur13 Vedåbrukeulikekombinasjoneravdissefaktorenekantreneremodulereintensitetenog kontrolleredenaerobetreningspåvirkningeninnenforhøyintensitetssonen(impellizzeri 2009). 3.0 METODEogGJENNOMFØRING Metodeer,ifølgeHalvorsen(1993:15),snevertdefinert"denhåndverksmessigesidenav vitenskapeligvirksomhet,ellermerpresistlærenomdeverktøysomkan benyttesforåinnsamleinformasjon".dettekapittelettarforsegmetodensomerblitt benyttetiforbindelsemedgjennomføringenavmineundersøkelser. 35

36 3.1 Metodologiensdesignogutforming Innhentingavinformasjonfraulikekildererenviktigforutsetningforenoppgavesom dette.enhveroppgavekreverogsågjennomgangavdemetodersomernødvendigfor arbeidetmedtemaet. Foråfinneteoritiloppgavenminvarfaglitteraturogsamtalermedtoppidrettsmiljøeti Olympiatoppenviktigearenaer.Tipstillitteraturfikkjegogsåavulikepersonerjeghadde samtalermed,foreksempelsigmundaasen. Tilempiridelenvalgtejegåintervjuefirefysisketrenereinorsktoppfotballfrafireulike klubber,samtåinnhentenoetestmateriellsometutgangspunktforådrøfte problemstillingen.begrunnelsenforvalgavfireforskjelligetrenere,bunnerprimærti oppgavensomfang.valgavtrenereogklubbervarnoetilfeldigettersomdetvarmiljøer jegfikkinnspillpååkontakte.poengetformindelvarikkeågeneralisere,menheller skaffeetempiriskgrunnlagforålærenoe,ogkunnebelysenoentendenserjegfinneri klubbeneshverdag.dettevilgjenspeileforholdetmellomteoriogpraksis.jegopplevde positivitethosdeklubbenejegkontaktet,ogjegvarpåbesøkitoavdisse(rosenborgog Brann)oggjennomførtesamtaler/intervjupåtelefonmedStrømsgodsetogOdd Grenland. Detvarpåtoområdermineundersøkelserhaddefokuspåforåfåbelystmin problemstilling.pådenenesidenvillejeghenteinnerfaringerogresultateromkring hvordanulikeklubberinorsktoppfotballdriverfotballspesifikkfysisktrening,hvordan dissebyggeroppukesyklusogøvelsesutvalgknyttettildette.dettevillejegogså sammenlignemeddebesteiverden,ogsåiandreidretter.dessutenvillejegbenytte egneerfaringerfrateoriogåprøvedetteutsystematiskitreningsprosesseniløv Ham Fotballi2009. Måletmedmineundersøkelservarålæremeromhvordanfotballspesifikkfysisktrening kangidetbesteutbyttet.hervarimpellizzerisundersøkelseenreferanseformegimitt møtemedandreklubbmiljøer. 36

37 3.1.1 Kvalitativtogkvantitativt Innhentingavinformasjonkanbådehakvalitativtogkvantitativtpreg.Idenneoppgaven harjegbenyttetmegnestenutelukkendeavførstenevntekategori.jegvilidetfølgende sinoemeromminemetoder,ogpåbestemåteklassifisereogbegrunnedisse setti forholdtilaktuellteori,ogretningslinjerjegharfåttiforholdtiloppgaven. "Atställafrågoräroftadetlettastesättetatfåinformationom hurenpersonuppfattarellerkännerinförenföreteelseviintresserar ossför.(lantz1993:11). Intervjuharværtdeneneavminemåteråinnhenteinformasjonpå,menintervjusom samlebetegnelsekanrommebådekvalitetogkvantitet.medutgangspunktia.t. Lotherington,"Intervjusommetode"(1990),finnerjegstøtteforetskillemellomto intervjumetoder(s.1): "(...)kvalitativtintervju,detvilsi,deteropptildensomblirintervjuet åformuleresvarene.detteimotsetningtilkvantitativesombruker spørreskjemamedfastlagtesvaralternativ.idenførstetypenintervjuer viopptattavåforståintervjukandidatenskategoriseringavsin virkelighet,mensviidenandreeropptattavåfåintervjukandidatentil åplasseresinvirkelighetivårekategorier."(lotherington1990:1) Jegserutfradetteatjegharbenyttetmegavkvalitativmetodeforåsamleinformasjon gjennomintervjuer. Foråfåfremuliketestresultatersomkansupplereogunderstrekeintervjuene,harjeg benyttetmegavkvaltitativeundersøkelser.medklarevariabler,harjeginnhentetulike testresultaterellerforetatttestingselvmedbrukavdigitalehjelpemidler.disse undersøkelsene,hvorjeghargjennomførttestutføringererkvalitativemetoder.dette harværtgjortforåutfylledekvalitativeintervjuene.dermedhardetometodeneutfylt 37

38 hverandre,ogværtmedåhjelpemegtilåfåenkombinasjonavoversiktoginnsikt,noe somharværtavstorbetydning Kvalitativeintervjuer Jegtokibrukkvalitativtintervjublantdefysisketrenernejegintervjuetinnenforå kartleggehvordanklubbendriverfysisktrening.somforberedelsetildetteintervjuet, haddetrenernefåttendelinformasjonavmegpåtelefonomkringhvajegvaropptattav. Lotherington(1990)omtalertreulikeintervjutyper: Detuformelle,samtalendeintervjuet Detteintervjuetforegårsomensamtale.Påforhånderdetikkeavtaltatdeteret intervju,slikatsamtalepartnerenkanværeuvitendeomathaneriintervjusituasjonen. Dennetypenintervjugjørdetikkemuligåsetteoppenlistemedspørsmålpåforhånd, fordiintervjuereniforkantikkekanvitehvasomskjer,oghvadetkanblivesentligå spørreom.intervjuformenkreveratforskerenienperiodeertilstedeisituasjonen,ogat hanmåforetaettellertointervjuermedhverperson.denneformenerderformyebrukti forbindelsemeddeltakendeobservasjon.fordeleneratenletterekankommepå innsidenavintervjukandidaten,nettoppvedatenkjennertilkonteksten.detvilkreve sværtmyetidomenskalfåinnsystematiskinformasjon. Intervjuguidetilnærmingen Herharensattoppspørsmålellertemapåforhånd.Dennelistenkanfungeresomen sjekklisteellerhuskeliste.meningeneratintervjuerenformulererspørsmålunderveis,og eropptattavåfølgeoppdetintervjukandidatensier.intervjuetkanforegåmereller mindresomensamtale. Standardisertopen endedintervju Herharenettsettmednøyeuttenktespørsmål.Spørsmåleneerlagetmedtankepåat hverenkeltsomharblittintervjuetskalspørresomdetsamme,medsammeord,isamme rekkefølge.detbrukesnårdeterviktigåminimalisereulikheterispørsmålenesomstilles 38

39 tilintervjukandidatene.dettevilværespesieltaktueltderdeterflereforskjellige Skriftlig oppgave intervjuere.intervjuernesinnvirkningpåintervjukandidatvilreduseres,ogbearbeidingog videreanalyservilbligreiereennmed"løsere"spørsmål.fleksibilitetenreduseres imidlertid,ogmulighetenforoppfølgingsspørsmålreduseres,settiforholdtildenforrige formen. Intervjueneminevarnøyeforberedt.Jeghaddeenklaroppfatningavhvajegønsketå finnesvarpå,menvarsamtidigåpenforatjegkunnefåvitemer.derforlagetjegen huskerammepåforhånd,menutenåsetteoppklarespørsmålsformuleringer.samtidig varjegopptattavåfåskaptengod,flytendesamtaleomkringtemaene.mittmålvaråfå tiletintervjumedetuformeltogåpentpreg.detteønsketbunneriselvegrunnentil samtalen,jegvaruteetterålærenoe,ogfåetempiriskgrunnlagforvideredrøftinger. Utgangspunktetmåttederforværeydmykhetframinside. Spørsmålomhvorvidtjegskullebrukelydbåndunderintervjuetblediskutertpåforhånd. Utfratidligereerfaring,harjegsettatdetteerentidkrevendemetode,ogvalgtederforå sebortfradette. JegvilnåkommetilbaketilA.T.Lotherington(1990)sinetreintervjutyper,somjeg omtaltetidligereidetteavsnittet.dettegjørjegforåklassifisereminegenmetode. ILotheringtonsframstillingpoengteresdetatdetretypeneintervjukanlaseg kombinere.detteerogsåaktueltiforholdtilmineintervjuer.jegkombinertedeto førstenevnteintervjutypene.dajegmøttemineintervjuobjektervardetikkeframinside sagttydeligatjegskullehaetintervju,menmeratjegvillelærenoe.detteuformelle, samtalendeintervjuetblelikevelstrukturertgjennomminforhåndsoppførtesjekkliste somdelvisgårinnunderintervjuguidetilnærmingen.avsatttidtilintervjuetvari underkantaventime. 39

40 3.1.2Kvalitativeundersøkelser Jegvilleundersøkehvordanendringavforutsetningerinnenfordenfotballspesifikke fysisketreningensomblirutførtinorsktoppfotball,kunneendredetfysiskeutbyttet. Dermedkunnejegførstseomjegfikklignenderesultaterinnenfordesammeøvingene sombleskissertisamtalermeddefysisketrenerne,ogjegkunnegjøreendringerpådisse øvingeneforåsehvordandetteendretdetfysiskeutbyttet.herbenyttetjegmegav pulsmåleresomregistreringogfulgtedetenkelteforsøktettopppåengrundigog kvalitativmåte.jegvartilstedeiutprøvingen,ogdettemenerjegermedpåågjøre undersøkelsenmerpålitelig,idengradatevt.spørsmålsomdukketoppfårgradav sammesvar.dettemenerjegeretbidragtilågiundersøkelsenmerhold. Drøftingeneminevilkanskjeværeenkildetilnyeideer,vedatjegstillerspørsmåltil dagenspraksis.detåværeoppmerksompåspenningenmellomteoriogpraksis,kan kanskjeføremedsegnødvendignytenkninginnifysisktrening. Jegharbevisstbruktdennetankegangensomendelavmetoden,foråforsikremegom atjegikkeharutelattnoenviktigedeleravetlagshverdag,somkanhaavgjørende betydningforminedrøftingerogkonklusjon.samtidigviserdenatjegiarbeidetharvært innomallenivåeneforåhenteinnkildemateriale. 3.3 Vurderingavundersøkelsenskvalitet "Validitetenavhengeravhvadetersomermålt,omdetteerde egenskapeneproblemstillingengjelder.validitetenbetegneraltså datasrelevansforproblemstillingeniundersøkelsen."(hellevik1991:159). Formåletmedmineundersøkelservaråsamleinndatasomgavmegmulighettilå evaluereellervurderehvordandettrenesfotballspesifiktfysiskinorsktoppfotball,samt hvordanendringavforutsetningerkunneskapeendringerispillernesfysiskeutbytte. "Evalueringersystematiskinnsamlingavdataforåskiljaoganalysereverknadenaveit forsøkpååskapeendringpåeitgittområde"(halvorsen1993:70). 40

Arbeidsøkonomi: Arbeidsøkonomi er et mål på hvor mye energi en utøver forbruker på en gitt intensitet eller tilbakelagt distanse (teknikk)

Arbeidsøkonomi: Arbeidsøkonomi er et mål på hvor mye energi en utøver forbruker på en gitt intensitet eller tilbakelagt distanse (teknikk) PRESTASJONSUTVIKLING BEGREPSAVKLARING Aerob kapasitet: Aerob kapasitet representerer den totale aerobe energiomsetningen (oksygenopptaket) under en aktivitet og i løpet av en definert tidsperiode (VO 2

Detaljer

Et godt resultat. er konsekvensen av. En god prestasjon. er konsekvensen av. med. Foredrag sykkeltrening av Atle Kvålsvoll.

Et godt resultat. er konsekvensen av. En god prestasjon. er konsekvensen av. med. Foredrag sykkeltrening av Atle Kvålsvoll. Et godt resultat er konsekvensen av En god prestasjon er konsekvensen av Riktig aktivitet med Riktig kvalitet OLT s tilnærming til prestasjonsforbedring -på individnivå- Sette mål Tydeliggjøre krav Evaluere

Detaljer

INTENSITETSSONER. Olympiatoppen anbefaler at treningen deles inn i åtte intensitetssoner Inndelingen i de åtte intensitetssonene er gjort ut fra:

INTENSITETSSONER. Olympiatoppen anbefaler at treningen deles inn i åtte intensitetssoner Inndelingen i de åtte intensitetssonene er gjort ut fra: INTENSITETSSONER Olympiatoppen anbefaler at treningen deles inn i åtte intensitetssoner Inndelingen i de åtte intensitetssonene er gjort ut fra: hensikten med treningen i hver intensitetssone hvordan ATP

Detaljer

Leif Inge Tjelta: Utholdenhet og. utholdenhetstrening

Leif Inge Tjelta: Utholdenhet og. utholdenhetstrening Leif Inge Tjelta: Utholdenhet og utholdenhetstrening Utholdenhet (definisjon) Evne til å motstå tretthet Å opprettholde en gitt intensitet (styrkeinnsats, fart, etc) begrenses av graden av tretthet og

Detaljer

Hvordan trener verdens beste utholdenhetsutøvere, og hva kan vi lære av dem?

Hvordan trener verdens beste utholdenhetsutøvere, og hva kan vi lære av dem? Hvordan trener verdens beste utholdenhetsutøvere, og hva kan vi lære av dem? I den senere tid har enkelte forskningsmiljøer i Norge hevdet at trening med lav intensitet ikke har effekt, og at trening med

Detaljer

Treningslærekurs på NIAK

Treningslærekurs på NIAK Treningslærekurs på NIAK Emner: Treningsplanlegging Olympiatoppen, høsten 2014 Av: Espen Tønnessen Hva er treningslære? Definisjon Treningslære er læren om idrettstrening og forhold som er avgjørende for

Detaljer

Leif Inge Tjelta: Utholdenhet og. utholdenhetstrening

Leif Inge Tjelta: Utholdenhet og. utholdenhetstrening Leif Inge Tjelta: Utholdenhet og utholdenhetstrening Utholdenhet (definisjon) Evne til å motstå tretthet Å opprettholde en gitt intensitet (styrkeinnsats, fart, etc) begrenses av graden av tretthet og

Detaljer

Hvorfor ble de beste best? En casestudie av tre kvinnelige verdensenere i orientering, langrenn og langdistanseløp

Hvorfor ble de beste best? En casestudie av tre kvinnelige verdensenere i orientering, langrenn og langdistanseløp Hvorfor ble de beste best? En casestudie av tre kvinnelige verdensenere i orientering, langrenn og langdistanseløp Espen Tønnessen Fagsjef for trening ved Olympiatoppen olympiatoppen 22. februar 2011 side

Detaljer

Intensitetssoner (Olympiatoppen)

Intensitetssoner (Olympiatoppen) Intensitetssoner (Olympiatoppen) Her er en oversikt basert på treningserfaringer og teori utarbeidet av olympiatoppen Innformasjonen her er hentet fra boken "Utholdenhet, trening som gir resultater" og

Detaljer

Treningssider. denne artikkelen vil jeg ikke ta stilling til om påstanden er riktig eller gal, men kun kort presentere hvordan

Treningssider. denne artikkelen vil jeg ikke ta stilling til om påstanden er riktig eller gal, men kun kort presentere hvordan Hvordan trener verdens beste utholdenhetsutøvere? I den senere tid har enkelte forskningsmiljøer i Norge hevdet at trening med lav intensitet ikke har effekt, og at trening med høy intensitet er tilstrekkelig

Detaljer

TRENINGSVEILEDER ISHOCKEY del 3 Øvelsesbank fystrening

TRENINGSVEILEDER ISHOCKEY del 3 Øvelsesbank fystrening TRENINGSVEILEDER ISHOCKEY del 3 Øvelsesbank fystrening Treningsveilederen er et treningsfaglig grunnlag for optimal prestasjonsutvikling i Ishockey. Del 3 beskriver styrkeøvelsene og intensitetsstyring

Detaljer

TRENINGSVEILEDER ISHOCKEY del 1 treningsplanlegging

TRENINGSVEILEDER ISHOCKEY del 1 treningsplanlegging TRENINGSVEILEDER ISHOCKEY del 1 treningsplanlegging Innhold PLANSYKLUSEN... 2 ÅRSPLAN... 3 PERIODEPLAN... 4 1 Plansyklusen Behovet for systematisk treningsplanlegging følger som en konsekvens av klubbens

Detaljer

Bacheloroppgave. Elitesvømmeres subjektive oppfattelse av intensitet. av Bendik Durmisi Ahlstrøm Lars Henrik Skau Innleveringsfrist: 18.05.

Bacheloroppgave. Elitesvømmeres subjektive oppfattelse av intensitet. av Bendik Durmisi Ahlstrøm Lars Henrik Skau Innleveringsfrist: 18.05. Bacheloroppgave Elitesvømmeres subjektive oppfattelse av intensitet av Bendik Durmisi Ahlstrøm Lars Henrik Skau Innleveringsfrist: 18.05.2015 VF200 -Vitenskapsfilosofi Bachelor i osteopati Antall ord:

Detaljer

Treningslærekurs på NIAK

Treningslærekurs på NIAK Treningslærekurs på NIAK Emne: Spensttrening Av: Espen Tønnessen Dagens tema spensttrening: 1. Hva er spenst? 2. Hvilke faktorer bestemmer vår spenst? 3. Hvilke krav stilles det til spenst i idrett? 4.

Detaljer

b) Gjør rede for hvordan du lager en helhetlig treningsplan. Ta utgangspunkt i begreper som arbeidskravsanalyse og kapasitetsanalyse.

b) Gjør rede for hvordan du lager en helhetlig treningsplan. Ta utgangspunkt i begreper som arbeidskravsanalyse og kapasitetsanalyse. Oppgave 1: a) Gjør rede for grunnleggende prinsipper for trening. b) Gjør rede for hvordan du lager en helhetlig treningsplan. Ta utgangspunkt i begreper som arbeidskravsanalyse og kapasitetsanalyse. Oppgave

Detaljer

Hvordan forebygge løpeskader? Kenneth Myhre - kennethmyhre@outlook.com

Hvordan forebygge løpeskader? Kenneth Myhre - kennethmyhre@outlook.com Hvordan forebygge løpeskader? Agenda Hva er en løpeskade? Noen viktige treningsprinsipper Innhold og oppbygning av program Løpeteknikk Noen enkle råd på veien Hva er en «løpeskade»? All trening er belastning.

Detaljer

Arbeidskrav og rammeplaner for en internasjonal 5000m løper

Arbeidskrav og rammeplaner for en internasjonal 5000m løper Arbeidskrav og rammeplaner for en internasjonal 5000m løper I denne artikkelen vil vi skissere hvilke krav som stilles til en mannlig 5000 meter løper på internasjonalt nivå. På bakgrunn av de fysiske,

Detaljer

Legg puslespillet riktig!

Legg puslespillet riktig! Tren optimalt: Legg puslespillet riktig! [ingress] Fysioterapeuter er sentrale fagpersoner ved opptrening og rehabilitering etter overbelastninger og skader både for mosjonister og toppidrettsutøvere.

Detaljer

Utholdenhet Trening som virker

Utholdenhet Trening som virker Utholdenhet Trening som virker Artikkelen er et sammendrag av boken som Olympiatoppen har utgitt om utholdenhetstrening. I artikkelen er det beskrevet hvilke fysiske faktorer som er prestasjonsbestemmende

Detaljer

Optimalisering av utholdenhetstrening!

Optimalisering av utholdenhetstrening! .9. Optimalisering av utholdenhetstrening! Agenda Intensitetsstyring Hvordan trener de beste? Hva kan du lære av de beste? Formtopping Av Øystein Sylta oysteinsylta@hotmail.com CV Øystein Sylta Utdanning:

Detaljer

Kondisjons- og utholdenhetstrening

Kondisjons- og utholdenhetstrening Kondisjons- og utholdenhetstrening Jostein Hallén, Norges Idrettshøgskole Utholdenhet er viktig i de fleste idretter, og alle idrettsutøvere føler at god kondisjon er en forutsetning for å prestere godt

Detaljer

Intensitetsstyring m pulsklokke www.arildtveiten.com

Intensitetsstyring m pulsklokke www.arildtveiten.com Skedsmo 11.02.08 Intensitetsstyring m pulsklokke Utholdenhet: -Evnen til å arbeide m relativt høy intensitet over lengre tid. Aerob Utholdenhet Anaerob utholdenhet Aerob/anaerob: Enebakk Rundt mm: minst

Detaljer

Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2006

Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2006 Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2006 Harald Munkvold 1 Hva er utholdenhet Utholdenhet defineres som organismens evne til

Detaljer

Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2013

Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2013 Aerob utholdenhet er kroppens evne til å arbeide med relativ høy intensitet over lang tid. Harald Munkvold Høsten 2013 Harald Munkvold 1 Fysisk aktivitet -er alle kroppslige bevegelser som resulterer i

Detaljer

Års- og periodeplaner på 400m

Års- og periodeplaner på 400m Års- og periodeplaner på 400m Tabell 1: Veiledende års- og periodeplan for en fremtidig 400m løper i aldersklassen 13-14 år Treningsdager 20 80 30 60 145/ 3 Treningsøkter 20 80 30 60 145 / 3 Treningstid

Detaljer

Basistrening. Teknikktrening Utholdenhetstrening

Basistrening. Teknikktrening Utholdenhetstrening Basistrening Teknikktrening Utholdenhetstrening Hva er teknikk? Med teknikk i idrett mener vi utøverens løsningl av en gitt bevegelsesoppgave Teknikk i idretten Hensiktsmessig bevegelsesløsning Effektiv

Detaljer

Utholdenhetstrening for unge utøvere

Utholdenhetstrening for unge utøvere Utholdenhetstrening for unge utøvere Aerob kapasitet er den viktigste prestasjonsbestemmende faktoren i typiske utholdenhetsidretter. Aerob utholdenhet er viktig i andre idretter også for å være trent

Detaljer

Samarbeidsprosjektet treningskontakt

Samarbeidsprosjektet treningskontakt Samarbeidsprosjektet treningskontakt - en videreutvikling av støttekontaktordningen Utholdenhetstrening Lisa Marie Jacobsen Fysioterapeut Mål for undervisningen Få et innblikk i hva utholdenhetstrening

Detaljer

Samarbeidsprosjektet treningskontakt

Samarbeidsprosjektet treningskontakt Samarbeidsprosjektet treningskontakt - en videreutvikling av støttekontaktordningen Utholdenhetstrening Lisa Marie Jacobsen Fysioterapeut Mål for undervisningen Få et innblikk i hva utholdenhetstrening

Detaljer

Prestasjonsrettet hurtighetstrening

Prestasjonsrettet hurtighetstrening Prestasjonsrettet hurtighetstrening Hvordan trene hurtighet på en effektiv måte? Hurtighetstrening i lagballspill og friidrett Av: Espen Tønnessen Sett inn video Hurtighetstrening Sochi Dagens tema Hurtighetstrening:

Detaljer

Eksamen MFEL1050 HØST 2012

Eksamen MFEL1050 HØST 2012 Eksamen MFEL1050 HØST 2012 1. Hva er hypertrofi? a) Flere aktin og troponin proteintråder i parallell b) Flere aktin og myosin proteintråder i parallell c) Flere transkripsjoner av proteinene myoglobin

Detaljer

Styrketrening for syklister

Styrketrening for syklister Styrketrening for syklister Styrketrening - all trening som har til hensikt å bedre vår muskulære styrke (Raastad 2000) Hensikt - Bedre prestasjonsevne på sykkel Styrketrening for syklister Nyere forskning

Detaljer

EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2013.

EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2013. EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2013. Hver oppgave gir ett poeng, og har kun ett riktig svar. Det gis ikke trekk for feil svar. Oppgavearket

Detaljer

GJØR DEG KLAR! Svein Roar Kvamme, Personlig Trener Sprek og Blid Knarvik

GJØR DEG KLAR! Svein Roar Kvamme, Personlig Trener Sprek og Blid Knarvik GJØR DEG KLAR! Svein Roar Kvamme, Personlig Trener Sprek og Blid Knarvik KLAR PÅ 26 UKER BESKRIVELSE AV INTENSITETEN PÅ ØKTENE Jeg kommer til å bruke puls- og soneinndeling som beregnes i forhold til din

Detaljer

Ved stor deltakelse kan det være aktuelt å dele i flere grupper for å øke treningsutbyttet for den enkelte.

Ved stor deltakelse kan det være aktuelt å dele i flere grupper for å øke treningsutbyttet for den enkelte. VEILEDENDE TRENINGSPROGRAM HØSTEN 2015 Da er vi i gang med forberedelser til vintersesongen 2015-2016. Det legges herved ut veiledende treningsprogrammer for følgende grupper: Gruppe1: Trener allsidig

Detaljer

Treningslære - NIAK Test- og testprosedyrer

Treningslære - NIAK Test- og testprosedyrer Treningslære - NIAK Test- og testprosedyrer Av: Espen Tønnessen Testing av idrettsutøvere Hensikten med forelesningen er å gi en innføring i: Hvorfor man bør teste Hva som karakteriserer en god test Utarbeidelse

Detaljer

TRENINGSPROGRAM JEGERTROPPEN 10 UKER MOT OPPTAK

TRENINGSPROGRAM JEGERTROPPEN 10 UKER MOT OPPTAK TRENINGSPROGRAM JEGERTROPPEN 10 UKER MOT OPPTAK INNLEDNING Treningsprogrammet er ment som et verktøy for jenter som ønsker å søke Jegertroppen ved FSK. Hensikten med programmet er å forberede den enkelte

Detaljer

Treningslære 1 BELASTNING, TILPASNING OG PROGRESJON

Treningslære 1 BELASTNING, TILPASNING OG PROGRESJON Treningslære 1 BELASTNING, TILPASNING OG PROGRESJON TRE GRUNNPILARER I ALL TRENING «Én serie igjen! Dagens program har kostet krefter. Trening av maksimal styrke er krevende. Nå gjelder det å få opp fem

Detaljer

Testing. En kort orientering om testing av utholdenhet ved Idrettssenteret. Asgeir Mamen

Testing. En kort orientering om testing av utholdenhet ved Idrettssenteret. Asgeir Mamen Testing En kort orientering om testing av utholdenhet ved Idrettssenteret Asgeir Mamen Erklæring om testing Erklæring i forbindelse med undersøkelser ved Fysiologisk laboratorium, Idrettssenteret, 6851

Detaljer

Intervalltrening. - Et forsøk av hvordan intervalltrening over en intervensjonsperiode på fire uker kan påvirke militær fysisk prestasjonsevne.

Intervalltrening. - Et forsøk av hvordan intervalltrening over en intervensjonsperiode på fire uker kan påvirke militær fysisk prestasjonsevne. Intervalltrening - Et forsøk av hvordan intervalltrening over en intervensjonsperiode på fire uker kan påvirke militær fysisk prestasjonsevne. Kadett Sindre Haugerud Wold Bachelor i miltære studier; ledelse

Detaljer

Samarbeidsprosjektet treningskontakt

Samarbeidsprosjektet treningskontakt Samarbeidsprosjektet treningskontakt - en videreutvikling av støttekontaktordningen Styrketrening Lisa Marie Jacobsen Fysioterapeut Mål med undervisningen Få et innblikk i Hva styrketrening er De ulike

Detaljer

BOBLE- ELLER MERCEDESMOTOR? ET SLAG FOR SLAGVOLUMET, MAKSIMAL STYRKE OG FOTBALL. Kjære skivenner!

BOBLE- ELLER MERCEDESMOTOR? ET SLAG FOR SLAGVOLUMET, MAKSIMAL STYRKE OG FOTBALL. Kjære skivenner! 1 av 6 2009-01-25 15:25 BOBLE- ELLER MERCEDESMOTOR? ET SLAG FOR SLAGVOLUMET, MAKSIMAL STYRKE OG FOTBALL Kjære skivenner! Da har dere vært lenge i gang med forberedelser til den kommende skisesongen med

Detaljer

Vår filosofi hovedpunkt

Vår filosofi hovedpunkt Vår filosofi hovedpunkt Lederskapsfilosofi uansett virksomhet 1. Vær deg selv og gå foran som et godt eksempel, men samtidig vær ydmyk og villig til å utvikle og forandre deg. 2. Komponer og jobb i komplementære

Detaljer

Fotball kompleks idrett

Fotball kompleks idrett Løpetrening for fotball Trenerforum Flatås Fotball 9. februar 2010 Olav Bolland 1 Fotball kompleks idrett Fotballspill Taktikk Psyke Spilleforståelse Selvtillitt Motivasjon Disiplin Kreativitet Teknikk

Detaljer

Kompendium i Langrenn v/tor Oskar Thomassen Høgskolen i Finnmark

Kompendium i Langrenn v/tor Oskar Thomassen Høgskolen i Finnmark www.hifm.no Kompendium i Langrenn v/tor Oskar Thomassen Høgskolen i Finnmark * Arbeidskrav * Treningsplanlegging * Intensitetsstyring * Testing * Teknikk * Mental trening * Trenerrolle Finn Hågen Krogh.

Detaljer

Den daglige treningen er en evig balansegang mellom belastning, både b

Den daglige treningen er en evig balansegang mellom belastning, både b Treningsplanlegging Den daglige treningen er en evig balansegang mellom belastning, både b variert og spesifikt, og hvile. Utsagn som; trening er nedbrytende, det er under hvilen du blir bedre,, og skal

Detaljer

Vår filosofi hovedpunkt

Vår filosofi hovedpunkt Lederskapsfilosofi uansett virksomhet Vår filosofi hovedpunkt 1. Vær deg selv og gå foran som et godt eksempel, men samtidig vær ydmyk og villig til å utvikle og forandre deg. 2. Komponer og jobb i komplementære

Detaljer

Høgskolen i Telemark Avdeling for allmennvitenskapelige fag. Martin Hjort Sørensen Eirik Hanssen. Effekten av småbanespill på VO 2maks

Høgskolen i Telemark Avdeling for allmennvitenskapelige fag. Martin Hjort Sørensen Eirik Hanssen. Effekten av småbanespill på VO 2maks Mastergradsoppgave Martin Hjort Sørensen Eirik Hanssen Effekten av småbanespill på VO 2maks Høgskolen i Telemark Avdeling for allmennvitenskapelige fag Effekten av småbanespill på VO 2maks Martin Hjort

Detaljer

Effekten av 20 ukers løpstrening på utrente.

Effekten av 20 ukers løpstrening på utrente. Effekten av 20 ukers løpstrening på utrente. «Sprek 3» - en intervensjonsstudie. av Iselin Brandal Berge Masteroppgave i undervisningsvitenskap idrett/kroppsøving Det humanistiske fakultet 2015 DET HUMANISTISKE

Detaljer

Fagnytt nr. 1 2005 MEDLEMSBLAD FOR FRIIDRETTENS TRENERFORENING

Fagnytt nr. 1 2005 MEDLEMSBLAD FOR FRIIDRETTENS TRENERFORENING Fagnytt nr. 1 2005 MEDLEMSBLAD FOR FRIIDRETTENS TRENERFORENING Fridrettens Trenerforenings styre 2005 Formann: Lars Ola Sundt idksundt@online.no Øvelsesansvarlige: Kast: Trond Ulleberg janne.engebretsen@nssr.no

Detaljer

Ernæringsavdelingen Olympiatoppen 1

Ernæringsavdelingen Olympiatoppen 1 Hva skaper en god utøver? Kosthold og prestasjon Marianne Udnæseth Klinisk ernæringsfysiolog Precamp EYOF 19.01.2011 Talent Trening Kosthold Restitusjon M0tivasjon Fravær av sykdom og skader Utstyr Olympiatoppen

Detaljer

Norges Skøyteforbund. Styrke-, spenst-, hurtighets- og utholdenhetstrening

Norges Skøyteforbund. Styrke-, spenst-, hurtighets- og utholdenhetstrening Norges Skøyteforbund Styrke-, spenst-, hurtighets- og utholdenhetstrening Muskelarbeid Norges Skøyteforbund Trener I 2 Utvikling av kraft Utvikling av kraft kan skje når muskelen forkortes, holder en stilling

Detaljer

Norges Skøyteforbund. Styrke-, spenst-, hurtighets- og utholdenhetstrening

Norges Skøyteforbund. Styrke-, spenst-, hurtighets- og utholdenhetstrening Norges Skøyteforbund Styrke-, spenst-, hurtighets- og utholdenhetstrening Muskelarbeid Utvikling av kraft Utvikling av kraft kan skje når muskelen forkortes, holder en stilling eller forlenges Kraften

Detaljer

Agenda. 1 Introduksjon. 3 Grunnleggende pulstrening 4 Praksis. o Cardio Trainer og DesiQner. - Suunto og Movescount. - Suunto; klokker og belter

Agenda. 1 Introduksjon. 3 Grunnleggende pulstrening 4 Praksis. o Cardio Trainer og DesiQner. - Suunto og Movescount. - Suunto; klokker og belter POWERED BY SUUNTO Agenda 1 Introduksjon - Suunto og Movescount - Suunto; klokker og belter - sportskompaniet.no - iqniter 2 iqniter o Cardio Trainer og DesiQner 3 Grunnleggende pulstrening 4 Praksis 3

Detaljer

Treningsfilosofi i svømming

Treningsfilosofi i svømming Treningsfilosofi i svømming Veien mot medaljer i OL 2020 og 2024 Av: Av: Petter Løvberg (NSF), Kay-Arild Paulsen (NSF), Johan Setterberg (NSF), Beda Leirvaag (NSF), Tore de Faveri (NSF), Morten Eklund

Detaljer

Uke- og øktplaner for 400m (13-14 år)

Uke- og øktplaner for 400m (13-14 år) Uke- og øktplaner for 400m (13-14 år) Tabell 1: Veiledende uke- og øktplaner for en hard uke i forberedelsesperioden (oktober - november) : Fri Teknikk: Bevegelighet: Bevegelighet: Fri Fredag Fri Lørdag

Detaljer

EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2009.

EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2009. EKSAMEN MFEL 1050. Innføring i idrettsfysiologi - Trening for prestasjon, helse og livskvalitet. Vår 2009. Hver oppgave gir ett poeng, og har kun ett riktig svar. Det gis ikke trekk for feil svar. Sett

Detaljer

Talentutvikling i juniorlangrenn for herrer

Talentutvikling i juniorlangrenn for herrer Talentutvikling i juniorlangrenn for herrer En treårig analyse av treningsutviklingen til en mannlig juniorløper i langrenn, sett i lys av; signifikante andres betydning, motivasjonelle faktorer og rammevilkår

Detaljer

Forespørsel om deltakelse i forskningsprosjektet

Forespørsel om deltakelse i forskningsprosjektet Forespørsel om deltakelse i forskningsprosjektet Effekten av karbohydrat og protein på utholdenhetsprestasjon ~18 timer etter en hard treningsøkt Bakgrunn og hensikt Dette er et spørsmål til deg om å delta

Detaljer

BRUKERVEILEDNING HVORDAN REGISTRERE PROCEEDINGS REGISTRERING AV «DEL AV BOK/RAPPORT»

BRUKERVEILEDNING HVORDAN REGISTRERE PROCEEDINGS REGISTRERING AV «DEL AV BOK/RAPPORT» Current research information system in Norway BRUKERVEILEDNING HVORDAN REGISTRERE PROCEEDINGS Proceedings som utgis i en serie registreres som «Del av bok/rapport». Boken i serien må da først registreres

Detaljer

Samarbeidsprosjektet treningskontakt

Samarbeidsprosjektet treningskontakt Samarbeidsprosjektet treningskontakt - en videreutvikling av støttekontaktordningen Styrketrening Lisa Marie Jacobsen Fysioterapeut Mål med undervisningen Få et innblikk i Hva styrketrening er Positive

Detaljer

Optimalisering av sykkeltrening

Optimalisering av sykkeltrening Optimalisering av sykkeltrening Bent Rønnestad Høgskolen i Lillehammer Innhold Start tirsdag 18. november kl. 18.00: «Optimalisering av sykkeltrening» Kl. 18.00-18.50: Kort om sentrale faktorer for utholdenhetsprestasjon

Detaljer

Utholdenhet: Spenst: Styrke: Tirsdag. Teknikk: Hurtighetsutholdenhet: Utholdenhet: Spenst: Styrke:

Utholdenhet: Spenst: Styrke: Tirsdag. Teknikk: Hurtighetsutholdenhet: Utholdenhet: Spenst: Styrke: Uke- og øktplaner for 1500m (17-18 år) Tabell 1: Veiledende uke- og øktplaner i en hard uke i forberelsesperioden (oktober-november) Fredag Lørdag Hurtighets Hvile. Hvile evt. Langkjøring; 60 min/ 13 km

Detaljer

Bachelorgradsoppgave. Påvirkes VO 2max og Th an av 14 dager med mengdetreningsregime? Johan Riseth Hammer KIF350. Bachelorgradsoppgave i

Bachelorgradsoppgave. Påvirkes VO 2max og Th an av 14 dager med mengdetreningsregime? Johan Riseth Hammer KIF350. Bachelorgradsoppgave i Bachelorgradsoppgave Påvirkes VO 2max og Th an av 14 dager med mengdetreningsregime? Johan Riseth Hammer KIF350 Bachelorgradsoppgave i Kroppsøving og idrettsfag, faglærerutdanning, bachelorgradsstudium

Detaljer

Føler du deg frisk og opplagt og gira på å løfte deg fysisk i løpet av sommeren, så vær så god ;kjør på med en gang!

Føler du deg frisk og opplagt og gira på å løfte deg fysisk i løpet av sommeren, så vær så god ;kjør på med en gang! Sommertrening! Sommeren er her! En fantastisk tid til å få jobbet godt med det du ønsker å bli bedre på. Hva trenger du? Kjenn etter! Er kropp og sjel sliten etter en tøff vår sesong, så unn deg et par

Detaljer

Utviklingstrapp i orientering -bedre systematikk i treningsarbeidet

Utviklingstrapp i orientering -bedre systematikk i treningsarbeidet Utviklingstrapp i orientering -bedre systematikk i treningsarbeidet 6. Januar 2010 Anders Skjeset Innledning Utarbeidet av Erlend Slokvik, Egil Johansen, Jan Arild Johnsen og Bjørnar Valstad med bakgrunn

Detaljer

Fra kretsmester til Norgesmester

Fra kretsmester til Norgesmester Fra kretsmester til Norgesmester Finn Kollstad, 37 år Fagansvarlig utholdenhet NFIF Kretstrener KIF-trener Aktiv mosjonist 1.12 halvmaraton 2.35 maraton 5 barn Driver it-firma Kondisfabrikken Agenda Hvordan

Detaljer

En antologi er en bok bestående av en samling kapitler/artikler skrevet av ulike forfattere.

En antologi er en bok bestående av en samling kapitler/artikler skrevet av ulike forfattere. Current research information system in Norway BRUKERVEILEDNING HVORDAN REGISTRERE EN ARTIKKEL I EN ANTOLOGI En antologi er en bok bestående av en samling kapitler/artikler skrevet av ulike forfattere.

Detaljer

11. Studiet er gjennomført både kvantitativt med akselerometermålinger og kvalitativt gjennom observasjoner.

11. Studiet er gjennomført både kvantitativt med akselerometermålinger og kvalitativt gjennom observasjoner. Forord Denne masteroppgaven er skrevet ved Institutt for sosiologi og statsvitenskap ved NTNU i Trondheim. Utgangspunktet for valg av oppgave er en glødende interesse for fotball, både som faglærer på

Detaljer

Treningsprogram for ressursperiode

Treningsprogram for ressursperiode Om treningsplanen I Rye deler vi treningsåret inn i 7 perioder som vist på figuren. Inndelingen sikrer en stigning i programmet frem mot konkurranseperioden(e). I første omgang har vi laget treningsprogram

Detaljer

MED SUUNTO FITNESS SOLUTION

MED SUUNTO FITNESS SOLUTION _1 MED SUUNTO FITNESS SOLUTION MEDLEMSVEILEDNING Suunto Fitness Solution _3 KOM I GANG! Suunto Fitness Solution er en ny måte du kan få mer ut av treningen på. Systemet registrerer aktivitetene dine, gir

Detaljer

UTVIKLINGSTRAPPA I LANGRENN

UTVIKLINGSTRAPPA I LANGRENN UTVIKLINGSTRAPPA I LANGRENN !"#$%&$'()"*+,,+$-&+'(*.''! INNHOLD Forord 5 1. Utviklingstrappa som verktøy for utvikling av utøvere 6 Hvilke forutsetninger har de som lykkes? 7 2. Kravene som stilles til

Detaljer

Crossfit- og intervalltrening

Crossfit- og intervalltrening Crossfit- og intervalltrening - En intervensjon med to høyintensive treningsregimer sett opp mot effekten et fem ukers treningsprogram har på Krigsskolens fysiske eksamen. Kadett Bjørn Anders Fossum Engnæs

Detaljer

Arbeidskrav og treningsplanlegging i orientering

Arbeidskrav og treningsplanlegging i orientering Camp Norway, Oslo 301015 Arbeidskrav og treningsplanlegging i orientering Erlend Slokvik, Olympiatoppen Innlandet 3. november 2015 1 Olympiatoppen Arbeidskravsanalyse En arbeidskravsanalyse har som formål

Detaljer

Olympiatoppens synspunkter på trening for barn

Olympiatoppens synspunkter på trening for barn Olympiatoppens synspunkter på trening for barn Når vi skal omtale trening for barn i alderen ca 6 til ca 11 år er det nødvendig å avklare noen begreper og grunnleggende elementer før vi går inn på å omtale

Detaljer

RESTITUSJONSPLAN. Hvorfor skal vi planlegge?

RESTITUSJONSPLAN. Hvorfor skal vi planlegge? RESTITUSJONSPLAN Hvorfor skal vi planlegge? Familie Jobb Skole Fotball EKSEMPLET VISER HVORDAN INTENSITETSMÅLINGEN GIR GRUNNLAG FOR RESTITUSJONSPLAN JUNIOR ELVERUM. Intensitetsplanlegging: Uke av. bolk

Detaljer

Fett kan forbrennes på mange måter, og det er bare opp til deg hvilken måte du velger.

Fett kan forbrennes på mange måter, og det er bare opp til deg hvilken måte du velger. Kondisjonstrening eller styrketrening? Når forbrenner du mer fett? Fett kan forbrennes på mange måter, og det er bare opp til deg hvilken måte du velger. 1) PULSSONER: SONE % av PULS MAKSIMUM 5 90-100%

Detaljer

Treningsprogram fram mot Oslo triathlon.

Treningsprogram fram mot Oslo triathlon. Vår samarbeidspartner Polar har sammen med triathlonlegende Arild Tveiten fått utarbeidet et forslag til trenings fram mot Oslo triathlon. I følge Tveiten skal selv nybegynnere innen triathlon klare sprint

Detaljer

Innhold Våre bakgrunner: praktisk og teoretisk Innspillene fra påmeldingen Innledende betraktninger Skader og skadeforebygging Generelle treningsbegrep Vintertrening Stians bakgrunn Idrettsgymnas Interesse:

Detaljer

Treningsprogram for ressursperiode

Treningsprogram for ressursperiode Om treningsplanen I Rye deler vi treningsåret inn i 7 perioder som vist på figuren. Inndelingen sikrer en stigning i programmet frem mot konkurranseperioden(e). I første omgang har vi laget treningsprogram

Detaljer

Individuell skriftlig eksamen. IBI 315- Fysiologisk adaptasjon til trening. Mandag 26. mai 2014 kl. 10.00-14.00. Hjelpemidler: kalkulator

Individuell skriftlig eksamen. IBI 315- Fysiologisk adaptasjon til trening. Mandag 26. mai 2014 kl. 10.00-14.00. Hjelpemidler: kalkulator BACHELOR I IDRETTSVITENSKAP MED SPESIALISERING I IDRETTSBIOLOGI 2013/2015 Individuell skriftlig eksamen IBI 315- Fysiologisk adaptasjon til trening i Mandag 26. mai 2014 kl. 10.00-14.00 Hjelpemidler: kalkulator

Detaljer

INNHOLD 1. Utviklingstrappa som verktøy for utvikling av utøvere 2. Kravene som stilles til morgendagens topputøvere

INNHOLD 1. Utviklingstrappa som verktøy for utvikling av utøvere 2. Kravene som stilles til morgendagens topputøvere 1 INNHOLD Forord 4 1. Utviklingstrappa som verktøy for utvikling av utøvere 5 Hvilke forutsetninger har de som lykkes? 7 2. Kravene som stilles til morgendagens topputøvere 9 Aerob og anaerob utholdenhet

Detaljer

Norges Skøyteforbund

Norges Skøyteforbund Norges Skøyteforbund Utvikling av fysiske, tekniske og mentale ferdigheter for hurtigløp på skøyter Utviklingstrapper Fysiske arbeidskrav og testbatteri Prestasjonsutvikling Trenings- og intensitetsstyring

Detaljer

Intervalltrening Intervalltrening blir gjerne delt inn i lang intervalltrening og kort intervalltrening.

Intervalltrening Intervalltrening blir gjerne delt inn i lang intervalltrening og kort intervalltrening. Leif Inge Tjelta Treningsintensitet i utholdenhetstreningen sett i sammenheng med hjertefrekvens, laktatverdier og konkurransefart Innledning Hjertefrekvensmålere blir i dag brukt av mange utøvere i utholdenhetsidretter

Detaljer

Fotballteori og pedagogikk

Fotballteori og pedagogikk Fotballteori og pedagogikk Innholdsfortegnelse FOTBALLTEORI... 1 Læringsteoretisk utgangspunkt/ Trenerens tilnærming til spiller og lag... 1 Aktivitetsprinsippet... 2 Spesifisitetsprinsippet... 2 Gjenkjenning

Detaljer

27 Ons 19.30 Sør hallen Trening Ballkontroll tid rom valg og utførelse. 5er Høy ¼ bane 90 min. (D)

27 Ons 19.30 Sør hallen Trening Ballkontroll tid rom valg og utførelse. 5er Høy ¼ bane 90 min. (D) Fokus i januar: Den individuelle og relasjonelle dimensjonen. Januar. Kl. Sted Aktivitet Tema: Intensitet: Div. Info. Uke 53 Egen fysisk trening i romjulen. 1 Fre Fri 2 Lør Fri 3 Søn Fri Uke 1 Vi starter

Detaljer

Midt på den ene langsiden skal brystkassen berøre underlaget. Forlengs eller sidelengs rulle er ikke tillatt

Midt på den ene langsiden skal brystkassen berøre underlaget. Forlengs eller sidelengs rulle er ikke tillatt Kondisjonstest - løp Løp i gymsal rundt markører med en varighet på 6 minutter. Det løpes i en rektangelformet bane på 44m, langsider er 15m og kortsider er 7m. To hindringer pr runde Midt på den ene langsiden

Detaljer

Per Ola Gasmann Masteroppgave i idrettsvitenskap

Per Ola Gasmann Masteroppgave i idrettsvitenskap k Per Ola Gasmann Effekter av åtte ukers aerob utholdenshetstrening under anaerob terskel på prestasjonsevne, maksimalt oksygenopptak, utnyttingsgrad og arbeidsøkonomi hos godt trente mannlige langrennsutøvere

Detaljer

Treningsprogram for OSI Friidrett 2. november - 31. desember

Treningsprogram for OSI Friidrett 2. november - 31. desember Treningsprogram for OSI Friidrett 2. november - 31. desember Uke 45 (2. november - 8. november): : 30x45s p 15s jogg. : Jeg ser det litt an hvem som er på trening. Kort pause. Kondisjon type Grete Waitz.

Detaljer

Treningslærekurs på NIAK

Treningslærekurs på NIAK Treningslærekurs på NIAK Emner: PERIODEPLANLEGGING, Våren 2014 Av: Espen Tønnessen En kartlegging av utøverens utviklingsnivå på de områder som fremkommer i arbeidskravsanalysen. Arbeidskravsanalyse og

Detaljer

Sammenligning av fettoksideringen og energiforbruket under intervalltrening og kontinuerlig trening blant godt trente menn

Sammenligning av fettoksideringen og energiforbruket under intervalltrening og kontinuerlig trening blant godt trente menn Sammenligning av fettoksideringen og energiforbruket under intervalltrening og kontinuerlig trening blant godt trente menn Karianne Vassbakk Brovold Veileder og biveileder Stephen Seiler og Ken Joar Hetlelid

Detaljer

ELIXIA Convention 2009

ELIXIA Convention 2009 Vektreduksjon og fettforbrenning Hvordan beholde muskler og forbrenne fett! Hvorfor dette emnet? Fordi deltakerne på gruppetimer har dette som mål Fordi PT-kundene har dette som mål Fordi vi selv har dette

Detaljer

Nye utgaver Gymnos og Gym

Nye utgaver Gymnos og Gym Nye utgaver 2009 Gymnos og Gym Kroppsøving for den videregående skole Vg1, Vg2, Vg3 ASBJØRN GJERSET, KJELL HAUGEN, PER HOLMSTAD, RAGNHILD LIED, ESPEN TØNNESSEN, ASTRI ANDRESEN Gymnos LÆREVERKET BESTÅR

Detaljer

«Ingen blir best åleine alle blir betre saman» Lengst mulig best mulig

«Ingen blir best åleine alle blir betre saman» Lengst mulig best mulig «Ingen blir best åleine alle blir betre saman» Lengst mulig best mulig Av: Espen Tønnessen, Olympiatoppen Olympiatoppens filosofi Sammen om de store prestasjonene Gjøre de beste litt bedre Arbeid på tvers

Detaljer

Effektiv restitusjon etter trening og konkurranser

Effektiv restitusjon etter trening og konkurranser Effektiv restitusjon etter trening og konkurranser Fysisk trening påfører kroppen ulike typer stressreaksjoner og tapper kroppen for væske og næring. Intensiteten i og varigheten av den enkelte treningsøkt

Detaljer

Steinkjer Fotballklubb FOTBALL. Hospitering

Steinkjer Fotballklubb FOTBALL. Hospitering FOTBALL Hospitering Bakgrunn Strategiprosessen i 2005 avdekket 4 viktige faktorer som vektlegges i tida fremover: 1) trenerutvikling 2) øke den generelle treningsmengden 3) legge til rette for gode hospiteringsordninger

Detaljer

Styrketrening for eldre lev lengre og bedre!

Styrketrening for eldre lev lengre og bedre! Styrketrening for eldre lev lengre og bedre! Håvard Østerås Spesialist i idrettsfysioterapi, Rosenborgklinikken Førstelektor og leder av fysioterapeututdanninga, Høgskolen i Sør-Trøndelag Gammel & aktiv

Detaljer

RENTRENING. Treningsråd, kosttilskudd og doping

RENTRENING. Treningsråd, kosttilskudd og doping RENTRENING Treningsråd, kosttilskudd og doping TIPS OG ERFARINGER DET BESTE FOREBYGGENDE TILTAKET MOT DOPINGBRUK ER Å INFORMERE OM HVORDAN KLARE Å OPPNÅ OMTRENT TILSVARENDE UTSEENDE UTEN Å BRUKE NOE SOM

Detaljer

Fysisk trening/basistrening for unge fotballspillere

Fysisk trening/basistrening for unge fotballspillere Fysisk trening/basistrening for unge fotballspillere 28 år gamle Ronaldo trener halvannen time med Real Madrid hver dag, men det er ikke nok. - halvtime med eksplosiv sprinttrening, - time i klubbens styrkerom.

Detaljer

IDRETT, KOSTHOLD OG VÆSKETILFØRSEL

IDRETT, KOSTHOLD OG VÆSKETILFØRSEL IDRETT, KOSTHOLD OG VÆSKETILFØRSEL NÅR DU HAR LEST DETTE KAPITLET, SKAL DU KUNNE gjøre rede for hva som er et sunt kosthold gjøre rede for den betydningen et variert kosthold og tilfredsstillende væsketilførsel

Detaljer