Assosiasjonen!mellom!skulderstyrke!og! hypermobilitet!hos!unge!konkurransesvømmere!

Størrelse: px
Begynne med side:

Download "Assosiasjonen!mellom!skulderstyrke!og! hypermobilitet!hos!unge!konkurransesvømmere!"

Transkript

1 Assosiasjonenmellomskulderstyrkeog hypermobilitethosungekonkurransesvømmere Theassosiationbetweenshoulderstrengthand hypermobilityinyoungcompetitiveswimmers Utarbeidetav: EirinS.Lunke CathrineRøgholt MarnaØkland

2 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Assosiasjonenmellomskulderstyrkeoghypermobilitethos ungekonkurransesvømmere Internveileder: Eksternveileder: JetteDamgaardJeppesen BirgitJuulKKristensen Anslag: Samletantallanslag:62956 Ordiabstrakt: Norsk:249 Engelsk:297 Denne opgave eller$ dele$ heraf$ må# kun# offentliggøres# med# forfatter(nes# tilladelse# jf.# Bekendtgørelseaflovomophavsretnr.202af Oppgavenerskrevetav:EirinS.Lunke,CathrineRøgholtogMarnaØkland. Bachelorprosjektifysioterapiutdannelsen,vedUniversityCollegeLillebælt,11.Juni2015. EirinS.Lunke CathrineRøgholt MarnaØkland Vivilgjernetakkefølgendepersonerforhjelpogveiledningiforbindelsemedoppgaven: JetteDamgaardJeppesen BirgitJuulKKristensen TinaJunge HansKromannKnudsen Alleinvolvertesvømmere Alleinvolvertesvømmeklubber Allefrivilligetestpersoner 1

3 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni Innholdsfortegnelse ABSTRAKT...4 ABSTRACT...5 INNLEDNING...6 PROBLEMBAKGRUNN...6 SVØMMESPORTENSUTBREDELSE...6 SKULDERSKADERISVØMMINGKFOREKOMSTOGRISIKOFAKTORER...6 MUSKELSTYRKEHOSHYPERMOBILEBARN...7 FYSIOTERAPEUTISKRELEVANS...8 FORMÅL...8 PROBLEMFORMULERING...9 FORSKNINGSSPØRSMÅL...9 BEGREPSAVKLARING...10 FORKORTELSER...10 DEFINISJONER...10 TEORI...10 FYSIOLOGISKEFORANDRINGERIPUBERTETEN...11 HYPERMOBILITET...11 MUSKELSTYRKE...13 MATERIALEOGMETODE...16 STUDIEDESIGN...16 STUDIEPOPULASJON...17 PRESCREENING...18 Testprotokoll*...*18 Målemetoder*...*18 Beigthon...18 Validitetogreliabilitet...19 RotèsQuérol...19 Validitetogreliabilitet...19 ISOKINETISKSTYRKEMÅLINGSTESTICYBEXNORM PRIMÆRTEST...19 Testprotokoll*...*19 Målemetoder*...*20 CybexNorm...20 Validitetogreliabilitet...20 ETISKEOVERVEIELSER...21 BIAS...22 LITTERATURSØKING...22 DATABEARBEIDING...25 Deskriptiv*Statistikk*...*25 Prediktiv*Statistikk*...*25 RESULTATER...27 DISKUSJON...31 EKSTERNVALIDITET...31 Resultater*...*31 Beigthon*test*og*Rotès*Quérol*...*33 Cybex*Norm*...*34

4 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni INTERNVALIDITET...34 Studiepopulasjon*...*34 Utførelse*av*tests*...*35 Databearbeiding*...*36 LITTERATURSØKING...37 KONKLUSJON...38 PERSPEKTIVERING...39 LITTERATURLISTE...40 BILAGSLISTE...46

5 Abstrakt EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Bakgrunn:Skulderskaderforekommerhyppighoskonkurransesvømmere.Muskelubalansei innadk og utadrotasjon i skulderen og hypermobilitet anses som risikofaktorer for skulderskader. Det er uvisst om det er en assosiasjon mellom generell hypermobilitet, skulderhypermobilitetogmaksimalmuskelstyrke. Formål: Prosjektets formål var å undersøke assosiasjonen mellom maksimal skulderstyrke ved innadk og utadrotasjon og generell hypermobilitet og skulderhypermobilitet, i en hypermobilgruppeogenkontrollgruppehoskonkurransesvømmereialderen10k16år. Metode: Dette studiet var en tverrsnittsundersøkelse med et casekkontrolldesign under prosjektet Physical Performance in Young Competitive Swimmers (PPYCS. 156 konkurransesvømmere i aldersgruppen 10K16 år ble testet for generell hypermobilitet og skulderhypermobilitetvedhjelpavbeightontestogendelavrotèsquérol.denendelige studiepopulasjonen(n=16varoppdeltienhypermobilgruppe(n=8ogenkontrollgruppe (n=8. Det bletestetformaksimalmuskelstyrke i innadk og utadrotasjon i skulderen i det isokinetiske dynamometeret Humac Cybex Norm 770. Dataene ble analysert som en multippellineærregresjonsanalyse. Resultat:Generellhypermobilitetogskulderhypermobilitetvarikkestatistisksignifikantfor noenavstyrkemålingene.detblesettentendenstilatdenhypermobilegruppenhaddenoe laverestyrkemålingerennkontrollgruppen.kjønnvistesegåværestatistisksignifikantfor styrkemålingeneiinnadrotasjoni60 /sek.og180 /sek. Konklusjon:Ut ifra den multiple lineære regresjonen konkluderes det med at generell hypermobilitetogskulderhypermobilitetikkevarstatistisksignifikantforstyrkemålingeneda det ble tatt høyde for kjønn, alder, høyde og vekt. Dette ble sett ved både innadk og utadrotasjon,samtratioenved60 /sek.og180 /sek. Nøkkelord:Svømmere,barn,hypermobilitet,skulderstyrke,skulderskader. 4

6 Abstract EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Background: Shoulder injuries frequently occurs in competitive swimmers. Muscle imbalanceininternalandexternalrotationintheshoulderandhypermobilityisconsidered as risk factors for shoulder injuries. It is unclear whether there is an association between generalizedjointhypermobility,shoulderhypermobilityandmaximummusclestrength. Objective:Thepurposeofthisprojectweretoexaminetheassociationofmaximummuscle strengthininternalandexternalrotationandgeneralizedjointhypermobilityandshoulder hypermobility,inahypermobilegroupandacontrolgroupincompetitiveswimmersaged 10K16years. Method:ThisstudyisacrossKsectionalstudywithacaseKcontroldesign,andisapartofthe project Physical Performance in Competitive Swimmers (PPYCS. 156 competitive swimmers aged 10K16 years were tested for generalized joint hypermobility and shoulder hypermobility, using the Beighton test and a part of the Rotès Quérol. The final study population(n=16weredividedintoahypermobilegroup(n=8andacontrolgroup(n=8. They were tested for maximum muscle strength in internal and external rotation of the shoulder, using the isokinetic dynamometer Humac Cybex Norm 770. The data were analysedasamultiplelinearregressionanalysis. Result: Generalized joint hypermobility and shoulder hypermobility was not statistically significant for any of the strength measures. There was a tendency that the hypermobile grouphadsomewhatlowerstrengthmeasuresthanthecontrolgroup.genderprovedtobe statisticallysignificantforstrengthmeasuresininternalrotationin60 /sec.and180 /sec. Conclusion:Basedonthemultiplelinearregression,theconclusionisthatgeneralizedjoint hypermobility and shoulder hypermobility was not statistically significant for strength measures,whengender,age,heightandweightweretakenintoaccount.thiswasseenat bothinternalandexternalrotation,andtheratio,inboth60 /sec.and180 /sec. Keywords:Swimmers,children,hypermobility,shoulderstrength,shoulderinjuries. 5

7 Innledning EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Physical Performance in Young Competitive Swimmers (PPYCS er et prosjektsamarbeid mellom University College Lillebælt og Syddansk Universitet som har pågått siden Prosjektet omhandler screening av fysisk prestasjon hos unge konkurransesvømmere i alderen10k16årfrasvømmeklubberpåfyn,danmark(bilag1.6studerendefordeltpå3 bachelorgrupper har samarbeidet om datainnsamling våren I tillegg har 3 kandidatstuderendeværtknyttetoppmotprosjektet. Problembakgrunn Svømmesportensutbredelse Det anslås at det oppstår over idrettsskader i Danmark i løpet av ett år. Dette inkludererbådeakutteogbelastningsrelaterteskader.detsesatomfangetogskadetypeni høygradavhengeravhvilkenidrettsgrensomdyrkes(1,s.15.skulderskaderforekommer ofteiidrettersomstillerstorekravtilskulderstyrkenoghvormestepartenavbevegelsene foregår over hodet, som eksempelvis i håndball, tennis og svømming (2. Hos konkurransesvømmere er skulderskader hyppigst, med en insidens på 40K80 % (3, 4. På grunnavdenhøyeinsidensenharbegrepet Swimmer sshoulder oppståttogbrukessom ensamlebetegnelseforsmertefullesymptomeriskulderenhossvømmere.ietsvømmetak, uavhengigavstilart,erinnadkogutadrotasjonsentralebevegelser(5.dettekangietøkt bevegelsesutslag og muskelubalanse mellom innadk og utadrotasjon, som igjen kan gi smerteriskulderenhossvømmere(6. Skulderskaderisvømming\forekomstogrisikofaktorer Bevegelsesutslageterenviktigfaktorforutviklingenavetkraftfulltsvømmetak.Studierviser at svømmere har økt bevegelsesutslag i skulderleddets utadrotasjon i forhold til ikkek svømmere (3, 7, 8, s Gjentagende belastninger i utadrotasjon og høy treningsmengde kan være årsaker til ervervet hypermobilitet (7, 9, s. 263,291. Økt bevegelsesutslagiflereledd,utoverdenantattgjennomsnittligebevegelsen,defineressom generellhypermobilitetogkanbliundersøktvedhjelpavbeightontest(10,s.191.kjønn, alder, etnisitet og hormonell påvirkning er alle faktorer som ser ut til å ha innflytelse på generellhypermobilitet(11,12.etstudieavzemeketal.(13harfunnetatelitesvømmere scorerhøyerepåbeigthontestforgenerellhypermobilitetennmosjonssvømmere.generell hypermobilitetanses som enmuligrisikofaktorforutviklingavskaderhosidrettsutøvere 6

8 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 (14.Videreerdetstudiersomindikereratgenerellhypermobilitethosbarnkanværeen risikofaktorforutviklingavsmertepåetseneretidspunktitenårene(15,s.215,16. For en svømmer stilles det store krav til kraftutvikling i skulderleddet da 90 % av den fremtredende kraft kommer fra armene (8, s Det er diskutert at skulderens bevegelsesutslag og muskelubalansen mellom innadk og utadrotasjon kan være to risikofaktorer til skulderskader og smerter hos svømmere (4. Elitesvømmere har en treningsmengde på 20K30 timer per uke. Det vil si at hver arm i gjennomsnitt utfører rotasjoneriløpetavetår(2.IfølgestudiettilBatalhaet.al.(17økerstyrkenved innadrotasjon i skulderen hos svømmere i løpet av sesongen, noe som kan føre til en muskelubalansemellominnadkogutadrotasjon.etannetstudieavbathalaetal.(18,har undersøkt isokinetisk styrke i innadk og utadrotasjon i skulderen hos unge konkurransesvømmere,sammenlignetmedikkeksvømmere.dettestudietkonkluderermed en økt muskelubalanse hos svømmere. Fenomenet er veldokumentert hos konkurransesvømmere,ogkanværeenavårsakenetilskaderiskulderen(17.itillegghar McMaster et al. (19 funnet en forskjell i utadk og innadrotasjonsratio hos svømmere og ikkeksvømmere. Muskelstyrkehoshypermobilebarn Et studie av Junge et al. (14 viser at hypermobile barn klarer å utvikle samme kraft ved SingleKLegKHopKforKDistancetestsomenkontrollgruppe. EMGKmålingeneviser enulikog uhensiktsmessig muskelrekruttering hos de hypermobile barna. Et annet studie som undersøkergenerellhypermobilitetogknestyrkefinneringensignifikantforskjellhosbarn medgenerellhypermobilitetiforholdtilkontrollgruppen.sammestudiefinneratjenterog kvinner med generell hypermobilitet har en lavere kneekstensjonsstyrke i forhold til kontrollgruppen(20.ettredjestudieviserenlavereagonistaktiveringihamstringogstørre koaktivering ved isometrisk knefleksjon hos hypermobile barn og voksne i forhold til kontrollgruppen(21.imotsetningkommerstudiettilhanewinkelkvankleefetal.(22med antagelseromathypermobilebarnharenlaveremuskelstyrkeennkontroller.detteviserat detersprikendeogmangelfulllitteraturnårdetkommertilundersøkelsersomomhandler barn,generellhypermobilitetogstyrke.dadeteruenighetinnenfordetteområdetbehøves det nærmere undersøkelse og mer forskning. På nåværende tidspunkt kan vi ikke finne studiersomundersøkermuskelstyrkeiskulderenhoshypermobileungesvømmere. 7

9 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Fysioterapeutiskrelevans Med bakgrunn i det ovenstående, ses det et behov for å belyse risikofaktorer og årsaksmekanismerinnenforskulderskaderhosungekonkurransesvømmere.forskningviser at generell hypermobilitet og muskelubalansen i innadk og utadrotasjon i skulderen kan være mulige risikofaktorer. Da det er mangelfull viten om generell hypermobilitet og ervervet hypermobilitet i skulderen hos svømmere, er det relevant med mer forskning innenfor området. Litteraturen konkluderer forskjellig med hvordan muskelstyrken ser ut hos barn med generell hypermobilitet. Dette gjør at man ikke kan si noe generelt om muskelstyrken,ogomstyrketreningkanværeetskadeforebyggendetiltakforhypermobile svømmere. Som tidligere nevnt er skulderskader hyppig hos svømmere. Det er viktig som fysioterapeut å kunne forstå årsaksmekanismer bak risikofaktorer for skader. Dette for å tilbyenmerspesifikkbehandlingidenkliniskepraksis,samtenmerrelevantforebyggende treningisvømmeklubbene. Formål Dette prosjektet er et kvantitativt sammensatt studie, en tverrsnittsundersøkelse med et casekkontrolldesign. Formålet er å undersøke assosiasjon mellom maksimal skulderstyrke ved innadk og utadrotasjon og generell hypermobilitet og skulderhypermobilitet, i en hypermobilgruppeogenkontrollgruppehoskonkurransesvømmereialderen10k16år. 8

10 Problemformulering EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Hva% er% assosiasjonen% mellom% maksimal% skulderstyrke% ved% innad4% og% utadrotasjon% og% generell% hypermobilitet% og% skulderhypermobilitet,% i% en% hypermobil% gruppe% og% en% kontrollgruppe%hos%konkurransesvømmere%i%alderen%10416%år? %% % Forskningsspørsmål 1. Hva er assosiasjonen mellom maksimal muskelstyrke i innadk og utadrotasjon i skulderenved60 /sek.oggenerellhypermobilitetogskulderhypermobilitetnårdet tashøydeforkjønn,alder,høydeogvekt? 2. Hva er assosiasjonen mellom maksimal muskelstyrke i innadk og utadrotasjon i skulderenved180 /sek.oggenerellhypermobilitetogskulderhypermobilitetnårdet tashøydeforkjønn,alder,høydeogvekt? 3. Hva er assosiasjonen mellom utadk og innadrotasjonsratio i skulderen og generell hypermobilitetogskulderhypermobilitetihenholdsvis60 /sek.og180 /sek.nårdet tashøydeforkjønn,alder,høydeogvekt? 9

11 Begrepsavklaring Forkortelser EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 GJH: Engelsk anerkjent forkortelse for Generalized Joint Hypermobility og anvendes i denneoppgavensomforkortelseforgenerellhypermobilitet. SH:Forkortelseforskulderhypermobilitet. IR:Engelskanerkjentforkortelseforinnadrotasjon.Denneforkortelsenbrukeskunitabeller. ER:Engelskanerkjentforkortelseforutadrotasjon.Denneforkortelsenbrukeskunitabeller. ROM: Engelsk anerkjent forkortelse for Range of Motion og anvendes i denne oppgave somforkortelseforbevegelsesutslag. CybexNorm:ErenforkortelseavdetisokinetiskedynamometeretHumacCybexNorm770. Definisjoner * > Idenneoppgavenvilcasegruppenbetegnessomdenhypermobilegruppen.Detsom liggeribetegnelseneratpersoneneergenerellhypermobilogskulderhypermobil. > I denne oppgaven vil den hypermobile gruppen og kontrollgruppen betegnes som studiepopulasjonennårdetsnakkesombeggegruppene. > 60 /sek.erenforklaringomatdynamometereterinnstilttilåarbeideisokinetisk, hvorvinkelarmenkuntillaterbevegelsei60 persekund. > 180 /sek.erenforklaringomatdynamometereterinnstilttilåarbeideisokinetisk, hvorvinkelarmenkuntillaterbevegelsei180 persekund. * * 10

12 Teori EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Dette*avsnittet*har*til*formål*å*danne*bakgrunnsviten*som*er*relevant*for*dette*studiet.*Først* blir* målgruppen* beskrevet* i* form* av* fysiologiske* forandringer* under* puberteten.* Videre* beskrives*hypermobilitet,*da*det*er*den*egenskapen*hos*målgruppen*som*er*interessant.*til* sist*utdypes*muskelstyrke*og*isokinetikk,*som*er*den*faktoren*vi*tester*for.** Fysiologiskeforandringeripuberteten Kjønnsmodningenstarterigjennomsnittved11Kårsalderenhosjentene,og1K2årsenerehos guttene.pubertetenkommertiluttrykkiblantannetvekst,kroppsligeforandringerogfysisk utvikling. Pubertetsstadiet fører til kjønnsspesifikke forandringer på grunn av kroppens stigendeproduseringavkjønnshormonerihypofysen.hormonenesetterigangutskillelseav østrogen (jenter og testosteron (gutter som resulterer i påvirkning av eggstokker og testikler.grunnetforskjelligtypehormonsesenulikutviklinghosjenteroggutter(23. Underveis i puberteten utvikler jenter og gutter seg ulikt. Hos begge forekommer det forandring av både muskelk og fettmasse. Jenter får en økning i fettmassen frem til 17K årsalderen.gutterderimot,harenøkningifettmassetil13kårsalderenogderetternedgang. Før puberteten ses ikke den store forskjell i muskelkraft hos jenter og gutter. Etter puberteten kan gutter i gjennomsnitt prestere høyere muskelkraft ( Det er flere grunner til dette, men det skyldes i stor grad de fysiologiske forandringer som øker muskelenskontraksjonsevne,betingetavhormonettestosteron.herunderstørrehjerteog lungersomgjøratblodetfårenhøyerehemoglobinprosent,såmeroksygentransporteres tilmusklene(23.høydeogvektharogsåensterkassosiasjonmedmuskelstyrken(26,27. Enannenforskjelleratjentersesmerbevegeligeenngutter.Flerestudierharsettpådenne sammenhengenogenforeslåttårsakeratdetkvinneligekjønnshormonharinnvirkningpå leddbevegeligheten(7,28.målgruppenidetteprosjekteterbarnogungemellom10k16år, hvornettoppdissepubertetsforandringenekankommetilsyneogspilleenbetydeligrolle fordenenkeltesvømmersprestasjon. Hypermobilitet Skulderleddet er et ledd med stort ROM. For optimal styring av skulderleddet under bevegelse,erdetavhengigavatdeaktiveogpassivestrukturerarbeidersammen.kapsel, ligamenter,brusk,labrumogknokler,somerdepassivestrukturene,holdercaputsentrerti ytterstillingavbevegelsesutslaget.deaktivestrukturer, somrotatorcuffmuskulaturenog 11

13 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 senenetilsupraspinatus,infraspinatus,teresminorogsubscapularis,samtsenentilbiceps, genererkraftogsikreratcaputholdessentrerticavitasunderbevegelse(29,s.192.somen forklaringsmodell har Manohar M. Panjabi oppsatt en modell som beskriver hvordan det aktivek,passivekogkontrollsystemetarbeidersammenforåunngåskaderimuskler,sener og ledd. Det aktive systemet og det passive systemet arbeider sammen med kontrollsystemetforåregulerebevegelsesutslaget.dersometavsystemeneernedsatt,skal deandresystemenekompensere(30,31. HypermobilitetkanforklaresmedatetellerflereleddharenøktROMutoverdenantatt gjennomsnittlige bevegelsesutslaget. Hvis dette forekommer i et ledd kalles det for lokal hypermobilitet. Den lokale hypermobiliteten ses som en ervervet tilstand, på grunn av gjentattebevegelseriytterstilling(9,s.291.gjeldertilstandenflereledkallesdetforgjh. GJHerentilstandsomansesmedfødtellerarvelig.Forensvømmerstillesdetstorekravtil kraftutviklingiskulderleddetda90%avdenfremtredendekraftkommerfraarmene(8,s. 446.IdenforbindelseharROMenstorbetydningforåkunnegenererekraftogskapeen effektivsvømmeteknikk(32.ensvømmerbringerskulderleddetiytterstillingfleregangeri løpetaventrening(8,s.446.dettekanføretiløktromiutadrotasjoniskulderen,somkan seshossvømmere(5,8,s Dengjentagendebelastningensammenmeddenhøye treningsmengdenkanovertidføretilatsenevevetblirløsere(9,s.263. GJHhosbarnhariflerestudierblittforbundetmedsmerteognedsattfunksjon(33,34.Iet studieavsohrbeckknøhretal.(35har301barnialderen8k10åridanmarkblittundersøkt forgjh.ved14kårsalderenbledetestetigjen.resultatettyderpåensammenhengmellom GJHibarndommenogleddsmerteriungdomsårene.Annenlitteraturviserathypermobilitet hosbarnnødvendigvisikkegirsmerteellernedsattfunksjon,tvertimotsesenbedretfysisk prestasjonsomfølgeavdenøktebevegeligheten.detsessomenfordelivisseidrettersom dansogturn(15,s.215.istudietavjungeetal.(14harengruppebarnmedgjhogen kontrollgruppe blitt registrert med like lang hoppelenge ved SingleKLegKHopKforKDistance test (SLHD. Selv om gruppene presterte likt i SLHD, hadde barn med GJH en ulik muskelrekruttering både før og etter landing,som kan være en økt risiko for traumatiske kneskader. Dette vil si at den hypermobile gruppen og kontrollgruppen kunne utvikle lik muskelstyrke. 12

14 Muskelstyrke EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Maksimal muskelstyrke defineres som den kraften en given muskelgruppe kan produsere over det involverte ledd. Den maksimale muskelstyrken avhenger av muskellengden, kontraksjonsformen og kontraksjonshastigheten. Graden av aktink og myosinoverlapp er bestemmende for kraftutviklingen som utvikles, og muskelstyrken avhenger da av muskelensaktuellelengdeogspenning(fig.1(36,s.43.spenningenifibreneoppstårførst når den strekkes ut over lengden 100. Lengden 100 kalles muskelfibrenes elastiske likevektslengdeogerdenhøyesteverdienførdetoppstårspenningimuskulaturen(37,s Fig%1.*Lengde%4%spenningsrelasjonen. Fig*1.*Lengde* *spenningsfiguren,*viser*at*den*totale*muskelkraft*ved*en*given*muskellengde* består*av*summen*av*både*passive*og*aktive*kraftutvikling.*passiv%spenning*=*den*hvilende* muskelfibers*lengde* *spenningskurve,*aktiveres*ved*lengden*100.*aktive%spenningsutvikling* =*kurve*over*den*aktive*spenningstilvekst.*den*maksimale*muskelstyrken*er*størst*i*midten*av* kurven*(ll.**total%spenning*=*den*aktive*spenningen,*fra*hvile*til*spenning*(38,*s.*44.** * Kontraksjonshastigheten, herunder muskelens energiproduksjonshastighet, betegnes som muskelens evne til å utvikle høy kraft og hastighet samtidig. Dette betegnes ofte som muskelenspowerproduksjonogseseksempelvishosgodekorttidsdistansesvømmere,dade er i stand til å bevege seg med høy hastighet samtidig som de produserer høy maksimal kraftutvikling.størrelsenavmuskelenspowererbetingetavdenmaksimalemuskellengden, 13

15 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 muskelstørrelsen, pennasjonsvinkel, den maksimale fiberforkortningshastighet og andelen avhurtigetype2muskelfibre(38,s.45.denkontraktilerateofforcedevelpoment(rfd, ogsåkaltdeneksplosivestyrke,angiverhvorrasktmuskelkraftenkanstigeinnenforsvært korttidiforbindelsemedeksplosivebevegelserogmaksimalakselerasjon.høyrfderviktig iforbindelsemedhurtigebevegelserforåkunneutviklestorkraftietbegrensettidsrom(fig. 2.* Fig%2.%Den%kontraktile%Rate%of%Force%Development%(RFD.% Fig*2.*RFD*kan*bestemmes*som*helning*på*kraftYtidskurven*eller*momentYtidskurven.*En*bratt* kurve*(høy*rfd*er*et*uttrykk*for*en*meget*eksplosiv*muskelkontraksjon*(38,*s.*53. Maksimal muskelstyrke kan måles ved hjelp av et isokinetisk dynamometer (fig 3. Isokinetikk kan defineres som bevegelse med motstand, samtidig med en konstant hastighet. Ved en isokinetisk styrkemålingstest vil leddvinkelhastigheten på bevegelsen forbli den samme, selv om motstanden endrer seg. Bevegelsen blir jevn og konstant da motstandentilpassersegdenmuskelkraftsomutviklesidengittebevegelse(38,s.209,39. I forskning anvendes ofte isokinetisk styrkemåling da det kan måle maksimal dynamisk kontraksjon.dagligdagsefunksjonerbestårihovedsakavisokinetiskebevegelser,ogdetgjør atmålingeneblirmersituasjonsbetingetimotsetningtileksempelvisisometriskemålinger. Metoden anses å være objektiv og gi pålitelige resultater da prosedyren enkelt kan 14

16 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 standardiseres(39.styrkemålingforetattietisokinetiskdynamometergirdirektemålfor styrken,uttryktinewtonmeter(nm(38,s.209.peaktorqueviserstyrkeverdienforhele leddbevegelsen,mensmakspeaktorqueeruttrykketsombrukesfordenmaksimaltmålte styrkeverdi i leddbevegelsen (fig. 4 (36, s. 52. Studier som anvender isokinetisk styrkemåling på svømmere bruker ofte Peak Torque som et mål når muskelstyrken sammenlignesmedenkontrollgruppe(4,19. Fig%3.%Cybex%Norm%dynamometeret.%% % Fig%4.%Innadrotasjon%utført%i%Cybex%Norm. % % Figur* 4.* Figuren* viser* Peak* Torque* i* innadrotasjon* hos* en* testperson* i* dette* studiet.* Maks* Peak*Torque*ligger*ca.*på*51,53*Nm.*ROM*er*satt*til*Y35 *til*60.* 15

17 Materialeogmetode EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 I* følgende* avsnitt* vil* metode* og* materiale* legges* frem.* Først* presenteres* studiedesign* og* studiepopulasjon.* Studiet* inneholder* to* forskjellige* testprosedyrer,* prescreening* og* isokinetisk* styrkemåling* i* Cybex* Norm* Y* primærtest.* Testprotokoller* og* målemetoder* presenteres* under* hver* enkelt* testprosedyre.* Datainnsamling* blir* presentert* fortløpende.* Deretter*blir*bias,*etiske*overveielser,*litteratursøking*og*databearbeiding*fremlagt.** Studiedesign Prosjektetbyggerpåetsunnhetsvitenskapeligperspektiv,hvorelementeravnaturK,humanK og samfunnsvitenskap flettes inn i hverandre, med hovedvekt på det naturvitenskapelige (40,s StudietvarbygdoppsomenkvantitativtverrsnittsundersøkelsemedetcaseK kontrolldesign.ientverrsnittsundersøkelseerformåletåundersøkeenstorgruppeforå finne en bestemt diagnose eller en tilstand. I dette studiet ble en gruppe unge konkurransesvømmerescreenet,hvortilstandengjhogshbleundersøkt.formåletmedet casekkontroll studie er å se på årsakssammenheng. Det ble i dette studiet undersøkt for assosiasjonenmellomisokinetiskmuskelstyrkeiinnadkogutadrotasjonoggjhogsh.forå vurdere evidensnivået i et studie brukes en hierarkisk modell, for å si noe om styrken og evidensen som tillegges et bestemt type studiedesign (tabell 1. CaseKkontroll og tverrsnittsundersøkelsetilleggesevidensnivåiiiogstyrkec(41,s.57. Tabell%1.%Evidenshierarkiet%% Tabell* 1.* Evidensnivåene* plassert* hierarkisk.* De* store* bokstavene* beskriver* styrken,* mens* romertallene*beskriver*graden*av*evidens*(41,*s.*57.* 16

18 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Etstudiedesignsomliggerlavereihierarkietkanlikeveltilleggesbetydning,dadetikkealltid kan være mulig å utføre undersøkelser eller finne studier på de høyeste nivåene i evidenshierarkiet innenfor det sunnhetsfaglige område. Man skal være kritisk til det som leses,ogvurderestudierogvitenskapeligeartiklerutframetode,resultaterogbias(41,s * Studiepopulasjon Prosjektetstartetmedenprescreening,der257konkurransesvømmereialderen10K16år, fordelt på 8 svømmeklubber på Fyn ble invitert til å delta. I prescreeningen ble 156 svømmeretestetutfrainklusjonskogeksklusjonskriterier(tabell2,ogutgjorde93(60% jenterog63(40%gutter.detutgjordeetfrafallpå101svømmere.prescreeningenbestod av Beighton test for GJH, med en score på 5 av 9, og Rotès Quérol som tester SH der minimumdominantarmmåtteværepositiv.11svømmerehaddebeggeinklusjonskriteriene (tabell 3. Kun 9 av disse ble invitert videre til den primæretestingen, da det fantes svømmeresomkunnebrukestilkontrollgruppemedkriteriene; 4av9*påBeigthontest, negativrotèsquérol,sammealder,kjønnogsvømmeklubb.totaltble14jenterog4gutter invitert til den primære test. 2 jenter uteble. Dermed utgjorde studiepopulasjonen 16 konkurransesvømmere(fig.5.* % Tabell%2.%Inklusjons4%og%eksklusjonskriterier%for%prescreening.% % Tabell%3.%Inklusjons4%og%eksklusjonskriterier%for%den%hypermobile%gruppen%til%primær%test.%% % % 17

19 Fig%5:%Flowchart.% EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Prescreening Testprotokoll Testprotokollen til prescreeningen ble fastsatt og standardisert i samarbeid med PPYCS prosjektet.testenesomblebenyttetvartotesterforhypermobilitet,beightontestforgjh og Rotès Quérol for lokal SH (bilag 2. Et scoringsark ble utviklet og standardisert til dokumentasjon og brukt til matching av studiepopulasjonen (bilag 3. Det ble gjort en gjennomgangavbeightonogrotèsquérolisamarbeidmedprosjektledere,videreøvingpå hverandreogmedstuderende.enpilottestblegjennomførtpåenskoleklassepåfyn,med barni11k12årsalderen.formåletvaråseomtestenkunnegjennomførespåaldergruppen samtåbliøvetitesten,daøvingforventesåøkeintertesterreliabiliteten(42. Målemetoder Beigthon% BeigthontestblebenyttetforåavdekkeGJHhossvømmerne.Testprotokollensomblebrukt tokavsettistudiettiljungeetal.(43.testenbestårav5generelleleddbevegelsermed9 18

20 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 deltester i alt. Den var enkel å gjennomføre og krevde minimalt med utstyr. Ved positiv deltestbledetscoret1poengogdenmaksimalesamledescorevar9.testerengjordeen subjektiv vurdering, med bruk av øyemål, om det var en økt bevegelighet ut fra standardisertemålitestprotokollen.vedenscore 4blevoksnepersonerregnetsomGJH. Litteraturen var uenig i hvilken cutkoff verdi som skal benyttes til barn og unge, men en score 5blirbruktifleretilfellerogogsåbruktveddettestudiet(15,s.207,43,44. Validitetogreliabilitet Beightontestblevurdertsomenvalidmålemetodehosungeialderen6K12årnårdetble bruktetgoniometertilåvurdererom(45.reliabilitetenblevurdertietstudieavjungeet al. (43, som viste at intertester reliabiliteten var moderat til substansiell dersom en standardisertprotokollbleanvendt.etstudieavjuulkkristensenetal.(42 konkluderteat reproduserbarhetenforbeightontestvargod,medkappaverdipå0,80.dersomenerfaren testerutførtebeigthontest,blereliabilitetenvurderthøy(46. Rotès%Quérol% RotèsQuérolerenhypermobilitetstestforskulder,cervikalcolumna,hofteogtær.Testen kan bli anvendt som et supplement til Beighton test for å avdekke hypermobilitet i flere ledd.skulderleddetinngårikkeibeightontestforgjh.dadetblevurdertatshkanvære interessant å avdekke hos svømmere, ble Rotès Quérol benyttet for å vurdere hypermobilitetiskulderleddet(42,47. Validitetogreliabilitet I et studie av JuulKKristensen et al. (42 ble reliabiliteten av Rotès Quérol vurdert. Kappaverdien lå mellom 0,31 og 0,80, og var generelt lavere enn Beigthon test. Studiet vurderte kappaverdien for hvert ledd. Høyre skulder hadde en verdi på 0,53 og venstre skulderpå0,79.detblekonkludertmedatdetvarbehovforflerestudierpåområdet,forå kunnevurderereliabilitetentilstrekkelig. IsokinetiskstyrkemålingstestiCybexNorm primærtest Testprotokoll TidligereiPPYCSprosjektetvardetutvikletentestprotokolltildynamometeretCybexNorm forisokinetiskstyrkemålingfleksjonogekstensjoniskulder.medinspirasjonfradenneble detutarbeidetenstandardiserttestprotokollforåkunnetestemaksimalisokinetiskstyrke ved innadk og utadrotasjon i skulderen (bilag 4. Det fantes en innstillingsmanual for 19

21 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 skulderrotasjon i ryggliggende (39. Utgangsstillingen ble endret til mageliggende med skulderen 90 abdusert og albue 90 flektert da denne posisjon var mer relevant for svømmere(48.studierharbenyttetforskjelligromitestvedinnadkogutadrotasjon(49, 50. På bakgrunn av lengdek spenningskurven ses det at en muskel produserer lite kraft i ytterstillinger av et ledd (fig. 1. Dette på grunn av aktink og myosinoverlapningen. Det tenkesogsåatdetvarenøktskaderisikovedmaksimaltmuskelarbeidiytterstillinger.etter avprøvningogdiskusjonmedfagpersonerblerominnskrenkettil60 utadrotasjonog35 innadrotasjonfrautgangsstillingen.målingeneihenholdsvis60 /sek.og180 /sek.blevalgt på bakgrunn av flere studier som har tatt utgangspunkt i disse hastigheter da det har sammenheng med den naturlige svømmehastigheten (51. Utvikling av testprotokollen i innadk og utadrotasjon ble gjort med bakgrunn i overstående litteratur og deretter fysisk avprøvningpåossselvogmedstuderende.pilottestblegjennomførtpåbarnidenaktuelle aldersgruppenforåseomdetvargjennomførbartogetiskforsvarlig. Hele testbatteriet ved den primære test bestod av VAS, høyde og vekt, standardisert oppvarming, isokinetisk styrkemålingstest av skulder i retningene fleksjon og ekstensjon, samtinnadkogutadrotasjon,håndgripsstyrkeogwosikspørreskjema(bilag5.testbatteriet bestodavflerekomponenterenndetsombleanvendtidetteprosjektet.dettepågrunnav atandreskulleundersøkesammestudiepopulasjon,menmedandreparametere. Målemetoder Cybex%Norm% Cybex Norm er et dynamometer som gir mulighet for å teste isokinetiske bevegelser i en given hastighet i grader per sekund. Motstanden blir justert etter testpersonens kraftutviklingogregistrererblantannetmakspeaktorqueunderbevegelsen.fordelenmed dynamometeret er at det gir et objektivt mål samt en muskelisolering da leddvinkelhastighetenblirholdtkonstant(39. Validitetogreliabilitet Detblefunnetenhøyreliabilitetmedenkorrelasjonkoeffisientmellom0.93og0.99ved brukavcybexnorm(52.etstudiesomundersøkteintermaskinkreliabilitetenmellomcybex NormogBiodex(etannetisokinetiskdynamometerfantenhøyreliabilitenogsamsvarende verdierforisometriskemålinger(53.ietstudieavgreenfieldetal.(54vardetfunneten høyerereliabilitetforinnadkogutadrotasjoniforholdtilfleksjonogekstensjon.deterogså 20

22 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 funnetatreliabilitetenøktevedbrukavstabiliseringavtruncus(55.gjennomgåendesesen høy validitet og reliabilitet, da utgangsstilling og innstilinger enkelt kan reproduseres ved isokinetiskedynamometeret(38,s.53. Etiskeoverveielser Før et sunnhetsvitenskaplig forskingsprosjekt påbegynnes skal det forekomme en vitenskapsetiskbedømmelseavdenvitenskapeligekomité,f. 13,stk.1ikomitéloven(56. PPYCS har søkt om godkjennelse fra den vitenskapelige komité og datatilsynet. Det ble vurdert at prosjektet ikke krevde anmeldelsesplikt da det ikke skulle gjennomføres en intervensjonogdetikkeoppbevaressensitivepersonopplysninger(bilag6. Daprosjektettokforsegbarnogungeialderen10K16årbledetstiltstørrekravtiletiske overveielser. Med utgangspunkt i Helsinki Deklarasjonen, som benyttes ved forskning og tester, omfatter det blant annet etiske prinsipper om frivillig deltakelse og samtykke. I henhold til deklarasjonen var det krav om frivillig deltakelse og at foreldre/foresatte skal kontaktes da studiepopulasjonen var under 18 år (56. Svømmeklubbenes trenere ble kontaktetpertelefon(bilag7.deretterbledetsendteninformasjonsmailtiltrenernehvor defikkbeskjedomåinformereforeldre/foresatteomprescreeningen(bilag8og9.herble foreldre/foresatteinformertomprescreeningenogfikkmulighetforfravelgelse. Invitasjontilvideretestblegjennomførtmedentelefonsamtaletilforeldre/foresatte(bilag 10, hvor informasjon og etiske vurderinger ble forklart. En mail ble sendt med informasjonsbrev(bilag11ogskriftligsamtykkeerklæringtildeutvalgtesvømmereogderes foreldre/foresatte (bilag 12. Brevet inneholdt informasjon om anonymitet, mulighet til å trekke samtykke uten begrunnelse og at personopplysninger ble oppbevart fortrolig. Samtykkeerklæringenmåtteleveresskriftligpåtestdagen.Samtykkeerklæringbleutformet påbakgrunnavdeformelleretningslinjerfra DetVidenskabsetiskeKomitésystem (56.For å sikre at svømmere med smerter ikke ble testet i Cybex Norm, ble det gjennomført en muntligogenskriftligdokumentasjonvedbrukavvasskalaforsmerteregistrering. Målingavhøydeogvektblegjortietavskjermetområdeforåunngåatstudiepopulasjonen følte seg utstilte. IDKnummer og de innsamlede data ble oppbevart separat og fortrolig. Undervåretesterbledetikkekommunisertomhvilketresultatdefikk,elleromdetvargodt ellerdårlig. 21

23 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Detvarfokuspåentryggogsikkerrammepåtestdagenforåskapeengodopplevelsefor studiepopulasjonen. Nøye informasjon, oppfølging og ros var satt i fokus. Foreldrene/foresatte hadde mulighet til å være tilstede, men ble anbefalt å holde seg i bakgrunn.defikkengjennomgangavhvasomskulleskjeførtestingenstartet. Studiepopulasjonen og deres foreldre/foresatte ble på forhånd informert om at ingen resultaterbleutgittsammenmednavn.svømmernefikketscoringsarkpåselvetestdagen sominneholdthøyde,vektoghåndgrepsstyrke(bilag13.enkontaktpersonbleoppgittmed mailogtelefonnummervedeventueltytterligerespørsmål. Bias Idettestudiemedenhypermobilgruppeogenkontrollgruppeblesystematiskebiasprøvd unngåttvedåmatchedetogrupperpåalder,kjønnogsvømmeklubb.pågrunnavtidspress og ressurser ble ikke alle svømmeklubber på Fyn invitert til å delta i prescreeningen,noe som kan ha gitt en seleksjonsbias. De største klubbene med konkurransesvømmere ble prioritert. Denne utvelgelsen kan ha påvirket den endelige populasjonen som kan ha påvirketresultatet.detbleikkegjortettilfeldigutvalgavkontrollgruppen,dademedlavest scorepåbeightontestblevalgtdersomdetvarfleremuligekontroller.dettevarforåsikre atkontrolleneikkeblescoret 4vedentilfeldigfeilellerenmålefeil. Foråunngåinformasjonsbiasbledetspurtinntilnåværendesmerterognormaldeltakelsei trening. Det ble ikke innsamlet informasjon om antall år på konkurranselag, deltakelse i andreidretter,generellfysiskaktivitetellerpubertetsstadiet.enstandardiserttestprotokoll for den primære testen, bleanvendtforatalleistudiepopulasjonenskullefådetsamme utgangspunktetiforholdtilpauserogrekkefølgeavtestene.detbleutførtsingelblinding foråunngåbias.svømmernefikkikkeoppgittomdevaridenhypermobilegruppeneller kontrollgruppen. Kun en av testerne visste hvilken gruppe deltakerne tilhørte og var lite aktividenprimærektestingen.enannenmålebiasidettestudietkanværeatcybexnorm ikkevarkalibrert. Litteratursøking Litteratursøkingenbleforetattframarstilmai2015,idatabasenePubMed,Cinahl,PEDro, GoogleScholarogCochane.DetbleanvendtMeshTermsogfritekst,samtsynonymertilde forskjelligehovedemnene(tabell4.foråspesifisereogkombineresøkeordbleordene OR og AND benyttet.enforutsetningvaratstudienevarskrevetpånorsk,svensk,danskeller 22

24 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 engelsk. Artiklene ble vurdert ut fra tittelens relevans og tydelighet, og deretter lest med fokus på relevant og tydelig metode, resultat og konklusjon. I starten ble det utført spesifikke,systematisertesøkiforholdtilhovedemnene.detgafå,ogurelevanteresultater. Derforblestrategienomgjorttilenbevissttilfeldigsøkning,hvordetblesøkt fritt. (57,s Metodenblebruktforåfåetbredtoverblikkoverhvasomfantesavlitteraturom relevanteemner.underveisbledetutførtkjedesøkninghvorreferanselistenietstudieble gjennomgått og førte oss videre til et annet studie. På den måten ble det mulig å finne primærlitteratur, samt å finne andre studier som omhandlet samme emne (57, s Denne søkemetoden ble brukt på flere artikler som var funnet ved den systematiske søkningensomf.eks.rewievettilremvigetal.detblefortløpendesøktetterstudier,somvi fantrelevante.samletbenyttetvi44studiersomblefunnetrelevant. Tabell%4.%Synonymer%til%litteratursøking.% % Densystematiskesøkningenbleutførtforåfinne litteratur til de spesifikke emner (57, s Underveis i søkeprosessen kom det frem at det var begrenset litteratur i forhold til målgruppen, spesielt unge konkurransesvømmere. Derfor ble studier innenfor en annen aldersgruppeelleridrettsgrenbenyttetvedenkelteanledninger,dadetvardenbesteviten 23

25 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 pågjeldendetidspunkt.detharblittsøktpådeforskjelligehovedemnenehverforseg,og samlet. Følgende vises et eksempel på en systematisk søkning i PubMed med emnene hypermobilitetogbarn(tabell5. Tabell%5.%Eksempel%på%et%søk%i%PubMed.%% Søket childrenandhypermobility ga 476 resultater. For å begrense resultatene ble det lagt til synonymer for hovedemnet hypermobilitet. Det neste søk hypermobility AND generalized joint hypermobility AND joint laxity AND children ga 42 resultater. Disse artiklene ble vurdert etter tittelens relevans og tydelighet i forhold til målgruppen og hypermobilitet.artiklersominneholdthypermobilitetssyndrombleutelukket,medmindre tittelenitillegginneholdtrelevantesynonymertilhypermobilitet.15artiklerblevurderttilå værerelevant.abstraktblevurdertettertydeligeogrelevantemål,metoder,resultaterog konklusjon (58, s Derfra ble 9 artikler utvalgt til videre lesning, hvorav 4 ble benyttet (tabell 6. Dersom artikler ikke var tilgjengelige i full tekst, ble det søkt i Google ScoolarellerbestilttilbiblioteketpåUCL. Tabell%6.%Valgte%artikler%ut%fra%ovenstående%søk.%% % 24

26 Databearbeiding EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 DeskriptivStatistikk I dette studiet ble det undersøkt for om det var en assosiasjon mellom den avhengige variabelenmaksimalskulderstyrkeiinnadkogutadrotasjon,måltisokinetisk,oggjhogsh, hos en hypermobil gruppe og en kontrollgruppe. Samtidig om kovariatene alder, kjønn, høydeogvekthaddeinnflytelse. Denprimæredatabestod avresultatenesamletinnfrastyrkemålingenicybexnormhos den hypermobile gruppen og kontrollgruppen. Sekundært var kovariatene alder, kjønn, høydeogvektbenyttet.foråfåetoverblikkoverallinnsamletdatableexcelbenyttethvor detviderebleoverførttildetstatistiskeprogrammetibmspss22.fordenviderestatistiske bearbeidingenvardetnødvendigåvitehvilkenskalatypedeninnsamlededatabefantseg på.deprimæredata,styrkemålingene(nmoggjhogsh,befantseghenholdsvispåratiok intervallkskalaogpåordinalknominalkskala.desekundæredataalder,høydeogvektbefant seg på ratiokintervallkskala, mens kjønn på ordinalknominalkskala. Formålet med den primære data var å finne assosiasjonen mellom maksimalmuskelstyrkeoggjhogsh.de sekundæredataenevisteomdehaddeeninnvirkningpådenprimæredatasresultater. Den videre statistiske metoden forutsatte at styrkemålingsresultatene var normalfordelte. DetillustreresvedhjelpavetQQKplot(fig.7ogbilag14ogboxplot(bilag14.Etterfølgende bledenhypermobilegruppenogkontrollgruppensammenlignetvedhjelpavenuparrettk test.detbleoppsattenh 0 Khypoteseomatdetikkevarforskjellidetogrupper.PKverdien fortktestenblesatttil0,05idettestudiet.tktestenbleutførtpåkovariatene h øydeogvekt, daviderestatistiskanalysetilsaatgruppeneskulleværesammenlignlige. PrediktivStatistikk Prediktiv statistikk gir uttrykk for hva som forventes å se i målgruppen på bakgrunn av studiepopulasjonen(59,s.11.detblevalgtenmultippellineærregresjondadettenkesat flere variabler har innvirkning på den maksimale muskelstyrken, ikke kun GJH og SH. En multippellineærregresjonsmodellblebenyttetforåsepåenassosiasjonmellommaksimal styrkeoggjhogsh,foråfåetmerrealistiskbildebledetkontrollertmedflerevariabler.pk verdienblesatttil0,05dadetteerdenmestanvendteverdien(59,s.20. % 25

27 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 % Tabell%7.%Formelen%for%multippel%lineær%regresjon.%% Det%er%spesielt%tre%informasjoner%som%er%interessante%når%det%ses%på%regresjonen; β\koeffisienten (heldingingskoeffisienten viser hvilken av variablene som har størst innvirkningpådenavhengigevariabelen. P\verdien(signifikansnivåviserhvorstorsannsynlighetenerforatresultatetianalysener tilfeldige. R 2 er forklaringsgraden og viste hvor stor påvirkning de uavhengige variabler har på den avhengigevariabel(60,s %antakelser%som%må%være%oppfylt%før%en%multippel%lineær%regresjon%gjennomføres*(61,*s.* 380:*** Antakelsenometlineærtforhold,altsåensammenheng,mellomavhengigvariabel (Yoguavhengigvariabel(X. Antakelsen om homoskedastisitet, som sier noe om at residualene har samme spredningomenhorisontallinje(gjennomsnittetforresidualene. Antakelsenomuavhengighet,altsåatavgivelseneerinnbyrdesuavhengige. Antakelsenomnormalfordelteresidualer. 26

28 Resultater EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 I* følgende* avsnitt* fremlegges* resultatene,* herunder* deskriptiv* og* prediktiv* statistikk. Det* primære*vi*ønsket*å*undersøke*var*assosiasjonen*mellom*maksimal*skulderstyrke*i*innady*og* utadrotasjon* i* skulderen* og* GJH* og* SH,* i* en* hypermobil* gruppe* og* en* kontrollgruppe.* Sekundert* ble* styrkemålingen* undersøkt* i* 60 /sek.* og* 180 /sek.* samtidig* som* det* ble* tatt* høyde* for* kjønn,* alder,* høyde* og* vekt.* Dette* ble* undersøkt* ved* en* multippel* lineær* regresjonsanalyse.* Fig.%6.%%Kjønnsoppdelt%aldersfordeling%av%studiepopulasjonen. Idettestudietvardettotalt16deltagere,fordeltpå4(25%gutterog12(75%jenter.Som detforekommerifigur6,sesenskjevfordelingavkjønnmedetflertallavjenter.majoriteten avdentotalestudiepopulasjonenlåpå13år. Tabell%8.%Spennvidde,%gjennomsnitt,%SD%og%p4verdi%fra%T4testen%for%høyde,%vekt%og%alder%i% den%hypermobile%gruppen%og%kontrollgruppen.%% 27

29 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Itabell8blirdetvistenoversiktoverdeskriptivedatatildenhypermobilegruppen(n=8og kontrollgruppen (n=8 som deltok i den primære testingen. Tabellen viste spennvidde, gjennomsnittogstandarddeviasjon(sdforhøyde,vektogalder.kjønnbleikkeinkluderti tabellen,dagruppeneblematchetpådennefaktoren.deskriptivedataforhenholdsvisden hypermobilegruppenogkontrollgruppenvisteatkontrollgruppenigjennomsnittvar1,3cm høyere og veide 2,9 kg mer. Det var en større spredning i høyde og vekt hos den hypermobile gruppen, noe som ga en større SD. En uparret TKtest ble utført i SPSS, hvor formåletvaråseomdetogruppenevarlikeiforholdtilkovariatene.detblesattoppenh 0 K hypotese;deterikkeforskjellidenhypermobilegruppenogkontrollgruppen.pkverdienfor høyden var 0,846 og for vekt var den 0,630. Da pkverdien var høyere enn 0,05 (det satte signifikansnivået,akseptertevih 0 Khypotesenogsaatdetikkevarforskjellidetogrupper. Tabell%9.%Spennvidde,%gjennomsnitt%og%SD%for%styrkemålingene%(Nm%for%den%hypermobile% gruppen%og%kontrollgruppen.%% Gjennomsnittetforstyrkemålingsresultatenei60 /sek.og180 /sek.haddeentendenstilå være noe lavere hos den hypermobile gruppen i forhold til kontrollgruppen. Ratioen ved 60 /sek.varlikforbeggegrupper,mensi180 /sek.varratioenstørreikontrollgruppen. % 28

30 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Fig.%7.%Q4Q4plot%for%normalfordelingen%i%utadrotasjon(ER%og%innadrotasjon%(IR. Enavantagelseneforåkunneutføreenmultippellineærregresjonsanalysevaratdataene skulleværenormalfordelte.dettebleundersøktvedhjelpavqkqplotogboxkplot(bilag14. I figur 7 ses det hvordan resultatene over styrkemålingene i utadk og innadrotasjon ved 180 /sek. fordelte seg om en linje. Alle resultatene ses tilnærmet normalfordelt på bakgrunnavutformingenavfigurene. I den prediktive statistikken presenteres mulige assosiasjoner mellom maksimal skulderstyrke i innadk og utadrotasjon og GJH og SH, i en hypermobile gruppe og en kontrollgruppe.detblegjortutfradenavhengigevariabelen,maksimalskulderstyrke(maks Peak Torque og den uavhengige variabel som var GJH og SH. Det ble inndratt flere kovariateriregresjonsanalysen,somkanhainnvirkningpådenavhengigevariabel. Tabell% 10.% Utvalgt% tabell% for% en% multippel% lineær% regresjonsanalyse;% Maks% Peak% Torque% i% innadrotasjon%ved%180 /%sek.%% 29

31 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 GJHogSHvarikkestatistisksignifikantfornoenavstyrkemålingene,dadetbletatthøyde forkjønn,alder,høyde,ogvekt(tabell11.iforholdtilkovariateneseskunkjønnstatistisk signifikantmedenverdipå0,042forstyrkemålingeneinnadrotasjon60 /sek.(tabell11og 0,038vedinnadrotasjon180 /sek(tabell10.umiddelbartsesenhøyforklaringsgrad,men dennekanikkeanvendesdadeflesteavvariableneikkevarstatistisksignifikante(bilag15.i forholdtilkjønnsesjenter16,087nmsvakereenngutter,somerreferanseverdien,nårde andreuavhengigevariableneholdeskonstante. Tabell%11.%%Oversikt%av%p4verdi%for%alle%styrkemålingene Itabell11visesallepKverdierforstyrkemålingeneiinnadKogutadrotasjoni60 /sek.og 180 /sek.samtratio.deterkunkovariatenkjønnsomvarstatistisksignifikantmedenverdi på0,042iinnadrotasjon60 /sek.og0,038iinnadrotasjon180 /sek.deandreverdieneses høyereenndensatteverdienpå0,05(5%. 30

32 Diskusjon EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 Diskusjonen*er*oppdelt*i*ekstern*og*intern*validitet.*I*den*eksterne*validiteten*diskuteres*og* sammenlignes* oppgavens* resultater* opp* mot* tidligere* utførte* studier.* Under* den* interne* validitet* diskuteres* metoden* i* forhold* til* hvordan* den* kan* ha* innvirkning* på* resultatene,* samt*metodens*styrke*og*begrensninger.*bias*blir*forklart*fortløpende.** EksternValiditet Resultater Formålet med denne oppgaven var å se på hva assosiasjonen var mellom maksimal muskelstyrke i innadk og utadrotasjon i skulderen og GJH og SH, hvor målgruppen var konkurransesvømmere i alderen 10K16 år som ble oppdelt i en hypermobil gruppe og en kontrollgruppe.idenmultiplelineæreregresjonsanalysenvardetingenstatistiskassosiasjon mellomgjhogshogdeforskjelligestyrkemål,dadetbletatthøydeforkjønn,alder,høyde og vekt. Dette ble sett ved både innadk og utadrotasjon, samt ratioen ved 60 /sek. og 180 /sek.detblefunnetenstatistisksignifikansfordenuavhengigevariabelenkjønnved innadrotasjon,i60 /sek.og180 /sek. Ettervårbestevitenfantesdetetbegrensetantallstudiersomharundersøktetlignende problemområde. På den annen side fantes det litteratur og studier som inneholder relevanteemnerogproblemstillingersomkananvendestildiskusjonavresultatene. Den multiple lineære regresjonsanalysen viste ingen statistisk assosiasjon mellom skulderstyrken,oggjhogsh,datalleneikkevistesegstatistisksignifikante.detkanvære mangeeksternefaktorersomharpåvirketresultatet.fordetførstekandetværeatgjhog SH i realiteten ikke hadde noen innvirkning på muskelstyrken i innadk og utadrotasjon i skulderen.detkanunderbyggesavblantannetstudiettiljungeetal.(14ogjensenetal. (62. Disse studiene viste at muskelstyrken ikke var nedsatt hos barn med GJH, men at muskelrekrutteringenogaktiveringenvarforskjelligfrakontroller.detkandiskutereshvor optimalt det var å trekke en parallell fra våre resultater til ovenstående studier. Studiene undersøkte kneleddet og musklene som arbeider over kneleddet. Anatomisk er skulderleddet og kneleddet forskjellige, og det er stor forskjell i muskelstørrelse og muskelaktiveringomkringknekogskulderleddet(63,s.279,180.dettevarfaktorersomgjør atmanbørværekritisktilåoverføreresultatenefrastyrkemålingomkringkneleddethos 31

33 EirinS.Lunke,CathrineRøgholt,MarnaØkland Juni2015 hypermobile barn til skulderleddet. Studiet kan på den annen side, gi en ide til hvordan muskelrekrutteringog Kaktivering kan arte seg i skulderleddet hos hypermobile barn. Selv om vi ikke finner en signifikant assosiasjon i muskelstyrken mellom den hypermobile gruppenogkontrollgruppen,kandettenkesatmuskelrekrutteringenkanværeforskjellig. EnmuligforklaringpåresultatetkantaavsettiPanjabi sstabilitetsmodell.detkantenkesat modellen forklarer hvorfor den hypermobile gruppen viste seg med samme styrke som kontrollgruppen.selveårsakentilhvorforenpersonvargjhogshkanikkeforklarespresist, menutfrateorienkanenforklaringhaværtøktelastisitetikapselogligamenter(30,31. ForklaresdetutfraPanjabi smodell,vildetpassivesystemetværenedsatt,ogatdetaktive systemet skal kompensere for å unngå skader. Forklaringen vil da være at det aktive systemetharklartåkompensereidissestyrkemål,ogdermedsesingenstatistisksignifikant effektavgjhogshistudiepopulasjonen. Ut fra formålet ønsket vi å undersøke om det var en assosiasjon mellom maksimal muskelstyrkeiinnadkogutadrotasjonoggjhogsh.medutgangspunktiteoriavsnittetvar det flere faktorer som påvirket muskelstyrken, derfor var fremgangsmåten en multippel lineærregresjonsanalyse.iresultatenevisteikkegjhogshsegstatistisksignifikant,menvi såatstyrkemålingenehaddeentendenstilåværenoelaverehosdenhypermobilegruppen iforholdtilkontrollgruppen(tabell9.detkantenkesatdersomstudiepopulasjonenhadde vært større, ville individuelle forskjeller i muskelstyrken i mindre grad ha påvirket den statistiskesignifikansen.enannenmulighetkanværeatdennetendensenkunnehakommet avtilfeldigemetodiskefeil,somforeksempelkjønnsfordelingogmåleapparatet.detteblir utdypetidiskusjonominternvaliditet. Sett ut fra resultatene kan det være andre faktorer som har en større assosiasjon på muskelstyrken enn GJH og SH. Ut fra resultatene i denne studiepopulasjonen var kjønn statistisksignifikant (tabell 15. βkkoeffisientenvisteatjentervil være16,087nmsvakere enngutteriinnadrotasjonved180 /sek.(tabell10og14,224nmsvakereved60 /sek.,når de andre uavhengige variablene holdes konstante (bilag 15. Dette kan underbygges av tidligere anvendt litteratur som har vist en sammenheng mellom muskelstyrke og kjønn, hvorguttergenereltvarsterkereennjenteripubertetsalderen(24.dettebegrunnesvedat ipubertetenøkermuskelmassenhosgutteristørregradennhosjenter(23.selvomkjønn fantesstatistisksignifikant,kandetikkeutelukkesatdetteskyldestilfeldigefeil.detvaret 32

Basistester for unge utøvere

Basistester for unge utøvere Basistester for unge utøvere I forbindelse med trening av unge utøvere, ønsker Olympiatoppen å gi råd om testing av basisferdigheter innenfor områdene stablitet/styrke i buk- og ryggmuskulatur, og bevegelighet

Detaljer

MASTER I IDRETTSVITENSKAP 2013/2015 MASTER I IDRETTSFYSIOTERAPI 2013/2015. Utsatt individuell skriftlig eksamen. STA 400- Statistikk

MASTER I IDRETTSVITENSKAP 2013/2015 MASTER I IDRETTSFYSIOTERAPI 2013/2015. Utsatt individuell skriftlig eksamen. STA 400- Statistikk MSTR I IRTTSVITNSKP 013/015 MSTR I IRTTSFYSIOTRPI 013/015 Utsatt individuell skriftlig eksamen i ST 400- Statistikk Mandag 5. august 014 kl. 10.00-1.00 Hjelpemidler: kalkulator ksamensoppgaven består av

Detaljer

Samarbeidsprosjektet treningskontakt

Samarbeidsprosjektet treningskontakt Samarbeidsprosjektet treningskontakt - en videreutvikling av støttekontaktordningen Styrketrening Lisa Marie Jacobsen Fysioterapeut Mål med undervisningen Få et innblikk i Hva styrketrening er De ulike

Detaljer

Diskusjonsoppgaver Hvilke fordeler oppnår man ved analytisk evaluering sammenliknet med andre tilnærminger?

Diskusjonsoppgaver Hvilke fordeler oppnår man ved analytisk evaluering sammenliknet med andre tilnærminger? Definisjonsteori Hva er de tre hovedtilnærmingene til evaluering? Nevn de seks stegene i DECIDE. (blir gjennomgått neste uke) Gi et eksempel på en måte å gjøre indirekte observasjon. Hva ligger i begrepene

Detaljer

Undersøkelse om utdanning

Undersøkelse om utdanning Undersøkelse om utdanning I dag er det flere som lurer på om det er en sammenheng mellom barn og foreldre når det kommer til valg av utdanningsnivå. Vi er veldig nysgjerrige på dette emnet, og har derfor

Detaljer

Appendiks 5 Forutsetninger for lineær regresjonsanalyse

Appendiks 5 Forutsetninger for lineær regresjonsanalyse Appendiks 5 Forutsetninger for lineær regresjonsanalyse Det er flere krav til årsaksslutninger i regresjonsanalyse. En naturlig forutsetning er tidsrekkefølge og i andre rekke spiller variabeltype inn.

Detaljer

Tabell 1: Antallet besøkende pasienter og gjennomsnittlig ventetid i minutter (fiktive data).

Tabell 1: Antallet besøkende pasienter og gjennomsnittlig ventetid i minutter (fiktive data). Viktige modeller og begrep Når du skal lese forskningsartikler, kan det være nyttig at du kjenner navnet på noen viktige modeller og begreper. Tekst: Hugo Lewi Hammer og Ketil Gundro Bruberg I de tidligere

Detaljer

OPPGAVESETTET BESTÅR AV 3 OPPGAVER PÅ 6 SIDER MERKNADER: Alle deloppgaver vektlegges likt.

OPPGAVESETTET BESTÅR AV 3 OPPGAVER PÅ 6 SIDER MERKNADER: Alle deloppgaver vektlegges likt. EKSAMEN I: MOT310 STATISTISKE METODER 1 VARIGHET: 4 TIMER DATO: 08. mai 2008 TILLATTE HJELPEMIDLER: Kalkulator: HP30S, Casio FX82 eller TI-30 Tabeller og formler i statistikk (Tapir forlag) OPPGAVESETTET

Detaljer

STUDIEÅRET 2012/2013. Utsatt individuell skriftlig eksamen. IBI 315- Fysiologisk adaptasjon til trening. Mandag 25. februar 2013 kl

STUDIEÅRET 2012/2013. Utsatt individuell skriftlig eksamen. IBI 315- Fysiologisk adaptasjon til trening. Mandag 25. februar 2013 kl STUDIEÅRET 2012/2013 Utsatt individuell skriftlig eksamen IBI 315- Fysiologisk adaptasjon til trening i Mandag 25. februar 2013 kl. 10.00-14.00 Hjelpemidler: kalkulator Eksamensoppgaven består av 5 sider

Detaljer

Profil Lavpris Supermarked Hypermarked Totalt. Coop Prix 4 4. Coop Extra 13 5. Coop Mega 7 7. Coop Obs 5 13. Rimi 24 24. Ica Supermarked 7 7

Profil Lavpris Supermarked Hypermarked Totalt. Coop Prix 4 4. Coop Extra 13 5. Coop Mega 7 7. Coop Obs 5 13. Rimi 24 24. Ica Supermarked 7 7 Vedlegg 1 - Regresjonsanalyser 1 Innledning og formål (1) Konkurransetilsynet har i forbindelse med Vedtak 2015-24, (heretter "Vedtaket") utført kvantitative analyser på data fra kundeundersøkelsen. I

Detaljer

MASTER I IDRETTSVITENSKAP 2013/2015 MASTER I IDRETTSFYSIOTERAPI 2013/2015. Individuell skriftlig eksamen. STA 400- Statistikk

MASTER I IDRETTSVITENSKAP 2013/2015 MASTER I IDRETTSFYSIOTERAPI 2013/2015. Individuell skriftlig eksamen. STA 400- Statistikk MASTER I IDRETTSVITENSKAP 013/015 MASTER I IDRETTSFYSIOTERAPI 013/015 Individuell skriftlig eksamen i STA 400- Statistikk Mandag 10. mars 014 kl. 10.00-1.00 Hjelpemidler: kalkulator Eksamensoppgaven består

Detaljer

Epidemiologi - en oppfriskning. Epidemiologi. Viktige begreper 12.04.2015. Deskriptiv beskrivende. Analytisk årsaksforklarende. Ikke skarpt skille

Epidemiologi - en oppfriskning. Epidemiologi. Viktige begreper 12.04.2015. Deskriptiv beskrivende. Analytisk årsaksforklarende. Ikke skarpt skille Epidemiologi - en oppfriskning Epidemiologi Deskriptiv beskrivende Hyppighet og fordeling av sykdom Analytisk årsaksforklarende Fra assosiasjon til kausal sammenheng Ikke skarpt skille Viktige begreper

Detaljer

Samarbeidsprosjektet treningskontakt

Samarbeidsprosjektet treningskontakt Samarbeidsprosjektet treningskontakt - en videreutvikling av støttekontaktordningen Styrketrening Lisa Marie Jacobsen Fysioterapeut Mål med undervisningen Få et innblikk i Hva styrketrening er Positive

Detaljer

KOGNITIV(FUNKSJONELL( TILGANG( !!!!!!

KOGNITIV(FUNKSJONELL( TILGANG( !!!!!! KOGNITIVFUNKSJONELL TILGANG # # Et#kvalitativt#intervjustudie#om#fem#utvalgte#fysioterapeuters# opplevelse#og#erfaringer#med#anvendelse#av#classification#based# Cognitive#Functional#Therapy#på#pasienter#med#NSCLBP#

Detaljer

UNIVERSITETET I OSLO

UNIVERSITETET I OSLO UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet Eksamen i: STK1000 Innføring i anvendt statistikk Eksamensdag: Onsdag 12. oktober 2016 Tid for eksamen: 10.00 12.00 Oppgavesettet er på

Detaljer

STUDIEÅRET 2012/2013. Utsatt individuell skriftlig eksamen. VTM 200- Vitenskapsteori og metode. Tirsdag 27. august 2013 kl

STUDIEÅRET 2012/2013. Utsatt individuell skriftlig eksamen. VTM 200- Vitenskapsteori og metode. Tirsdag 27. august 2013 kl STUDIEÅRET 2012/2013 Utsatt individuell skriftlig eksamen i VTM 200- Vitenskapsteori og metode Tirsdag 27. august 2013 kl. 10.00-12.00 Hjelpemidler: ingen Eksamensoppgaven består av 5 sider inkludert forsiden

Detaljer

Generelt om. trening, oppvarming, bevegelighet, uttøyning og avspenning

Generelt om. trening, oppvarming, bevegelighet, uttøyning og avspenning Generelt om trening, oppvarming, bevegelighet, uttøyning og avspenning Trening: All form for fysisk aktivitet kan ha positive effekter på fysisk, psykisk og sosial måte. Trening kan imidlertid deles inn

Detaljer

2. Hva er en sampelfordeling? Nevn tre eksempler på sampelfordelinger.

2. Hva er en sampelfordeling? Nevn tre eksempler på sampelfordelinger. H12 - Semesteroppgave i statistikk - sensurveiledning Del 1 - teori 1. Gjør rede for resonnementet bak ANOVA. Enveis ANOVA tester om det er forskjeller mellom gjennomsnittene i tre eller flere populasjoner.

Detaljer

Medisinstudiets særoppgave. Om å skrive særoppgave

Medisinstudiets særoppgave. Om å skrive særoppgave Medisinstudiets særoppgave Om å skrive særoppgave Hensikten med særoppgaven Mål: Vitenskapelig tilnærming en vitenskapelig tenke- og arbeidsmetode å bruke data- og litteratursøking innen medisinsk fagfelt/medisinsk

Detaljer

Prosjektbeskrivelsen består av

Prosjektbeskrivelsen består av Kvantitative hovedoppgaver: prosjektbeskrivelsen og litt om metode og utforming Knut Inge Fostervold Prosjektbeskrivelsen består av Vitenskapelig bakgrunn og problemformulering (ca 2 sider) Design og metode

Detaljer

Oppvarming. Modul 3.0. Læringsmål // Bevisstgjøre behovet for oppvarming og uttøyning for å øke prestasjonsevnen og forebygge skader.

Oppvarming. Modul 3.0. Læringsmål // Bevisstgjøre behovet for oppvarming og uttøyning for å øke prestasjonsevnen og forebygge skader. 48 Modul 3.0 Oppvarming Læringsmål // Bevisstgjøre behovet for oppvarming og uttøyning for å øke prestasjonsevnen og forebygge skader. Hovedpunkter Fysisk oppvarming Mental oppvarming Uttøyning etter skytetrening

Detaljer

Muskelsmerter kjønn eller arbeidsforhold?

Muskelsmerter kjønn eller arbeidsforhold? Muskelsmerter kjønn eller arbeidsforhold? Flere kvinner enn menn opplever smerter i nakke, skuldre og øvre del av rygg. Det er vanskelig å forklare dette bare ut fra opplysninger om arbeidsforholdene på

Detaljer

Kurs i kunnskapshåndtering å finne, vurdere, bruke og formidle forskningsbasert kunnskap i praksis. Hege Kornør og Ida-Kristin Ørjasæter Elvsaas

Kurs i kunnskapshåndtering å finne, vurdere, bruke og formidle forskningsbasert kunnskap i praksis. Hege Kornør og Ida-Kristin Ørjasæter Elvsaas Kurs i kunnskapshåndtering å finne, vurdere, bruke og formidle forskningsbasert kunnskap i praksis 16.mars 2007 Hege Kornør og Ida-Kristin Ørjasæter Elvsaas Nasjonalt kunnskapssenter for helsetjenesten

Detaljer

Kausalitet - Hvordan komme litt nærmere sannheten

Kausalitet - Hvordan komme litt nærmere sannheten Seniorforsker, professor Lise Lund Håheim Nasjonalt kunnskapssenter for helsetjenesten, Universitetet i Oslo Kausalitet - Hvordan komme litt nærmere sannheten Nasjonalt kunnskapssenter for helsetjenesten

Detaljer

STUDIEÅRET 2013/2014. Individuell skriftlig eksamen. VTM 200- Vitenskapsteori og metode. Fredag 25. april 2014 kl. 10.00-12.00.

STUDIEÅRET 2013/2014. Individuell skriftlig eksamen. VTM 200- Vitenskapsteori og metode. Fredag 25. april 2014 kl. 10.00-12.00. STUDIEÅRET 2013/2014 Individuell skriftlig eksamen i VTM 200- Vitenskapsteori og metode Fredag 25. april 2014 kl. 10.00-12.00 Hjelpemidler: ingen Eksamensoppgaven består av 5 sider inkludert forsiden Sensurfrist:

Detaljer

Epidemiologi - en oppfriskning. En kort framstilling. Er det behov for kunnskaper om epidemiologi?

Epidemiologi - en oppfriskning. En kort framstilling. Er det behov for kunnskaper om epidemiologi? Epidemiologi - en oppfriskning En kort framstilling Dere kan finne en kort gjennomgang av epidemiologifaget i et kapittel som jeg skrev i en bok. Jacobsen BK. Epidemiologi. I: Kvantitativ forskningsmetodologi

Detaljer

Grunnlaget for kvalitative metoder I

Grunnlaget for kvalitative metoder I Forelesning 22 Kvalitativ metode Grunnlaget for kvalitativ metode Thagaard, kapittel 2 Bruk og utvikling av teori Thagaard, kapittel 9 Etiske betraktninger knyttet til kvalitativ metode Thagaard, kapittel

Detaljer

STUDIEÅRET 2012/2013. Individuell skriftlig eksamen. VTM 200- Vitenskapsteori og metode. Onsdag 24. april 2013 kl

STUDIEÅRET 2012/2013. Individuell skriftlig eksamen. VTM 200- Vitenskapsteori og metode. Onsdag 24. april 2013 kl STUDIEÅRET 2012/2013 Individuell skriftlig eksamen i VTM 200- Vitenskapsteori og metode Onsdag 24. april 2013 kl. 10.00-12.00 Hjelpemidler: ingen Eksamensoppgaven består av 5 sider inkludert forsiden Sensurfrist:

Detaljer

Prosjektbeskrivelsen består av

Prosjektbeskrivelsen består av Kvantitative hovedoppgaver: prosjektbeskrivelsen og litt om metode Knut Inge Fostervold Prosjektbeskrivelsen består av Vitenskapelig bakgrunn og problemformulering (ca 2 sider) Design og metode (ca 2-3

Detaljer

STUDIEÅRET 2016/2017. Individuell skriftlig eksamen i STA 200- Statistikk. Torsdag 27. april 2017 kl

STUDIEÅRET 2016/2017. Individuell skriftlig eksamen i STA 200- Statistikk. Torsdag 27. april 2017 kl STUDIEÅRET 2016/2017 Individuell skriftlig eksamen i STA 200- Statistikk Torsdag 27. april 2017 kl. 10.00-12.00 Hjelpemidler: Kalkulator og formelsamling som blir delt ut på eksamen Eksamensoppgaven består

Detaljer

TRENINGSVEILEDER ISHOCKEY del 5 Arbeidskrav og testbatteri

TRENINGSVEILEDER ISHOCKEY del 5 Arbeidskrav og testbatteri TRENINGSVEILEDER ISHOCKEY del 5 Arbeidskrav og testbatteri Treningsveilederen er et treningsfaglig grunnlag for optimal prestasjonsutvikling i Ishockey. Del 5 beskriver testbatteriene for kvalitetssikring

Detaljer

Eksamen PSYC3101 Kvantitativ metode II Høsten 2013

Eksamen PSYC3101 Kvantitativ metode II Høsten 2013 Psykologisk institutt Eksamen PSYC3101 Kvantitativ metode II Høsten 2013 Skriftlig skoleeksamen, torsdag 17.oktober kl. 09:00 (3 timer). Sensur etter tre uker. Ingen hjelpemidler er tillatt under eksamen.

Detaljer

STUDIEÅRET 2011/2012. Individuell skriftlig eksamen. STA 200- Statistikk. Fredag 9. mars 2012 kl. 10.00-12.00

STUDIEÅRET 2011/2012. Individuell skriftlig eksamen. STA 200- Statistikk. Fredag 9. mars 2012 kl. 10.00-12.00 STUDIEÅRET 2011/2012 Individuell skriftlig eksamen STA 200- Statistikk i Fredag 9. mars 2012 kl. 10.00-12.00 Hjelpemidler: kalkulator. Formelsamling blir delt ut på eksamen Eksamensoppgaven består av 9

Detaljer

Oppgaver Oppgavetype Vurdering Status 1 ME-417, forside Flervalg Automatisk poengsum Levert. 2 ME-417, oppgave 1 Skriveoppgave Manuell poengsum Levert

Oppgaver Oppgavetype Vurdering Status 1 ME-417, forside Flervalg Automatisk poengsum Levert. 2 ME-417, oppgave 1 Skriveoppgave Manuell poengsum Levert ME-417 1 Vitenskapsteori og kvantitativ metode Kandidat 3704 Oppgaver Oppgavetype Vurdering Status 1 ME-417, forside Flervalg Automatisk poengsum Levert 2 ME-417, oppgave 1 Skriveoppgave Manuell poengsum

Detaljer

Forskningsmetode for sykepleierutdanningene

Forskningsmetode for sykepleierutdanningene Forskningsmetode for sykepleierutdanningene Boken har mange relevante, og i hovedsak norske eksempler på sykepleieforskning og gir en introduksjon til forskningsmetode for sykepleierutdanninger. Vurdering:

Detaljer

1. Introduksjon. Hva er dine forventninger til MEVIT2800? Hvordan er metode relevant? MEVIT januar 2012 Tanja Storsul

1. Introduksjon. Hva er dine forventninger til MEVIT2800? Hvordan er metode relevant? MEVIT januar 2012 Tanja Storsul 1. Introduksjon MEVIT2800 17. januar 2012 Tanja Storsul Hva er dine forventninger til MEVIT2800? A. Det kjedeligste BA-emnet. B. Det mest arbeidslivsrelevante BAemnet. C. Det mest underholdende BA-emnet.

Detaljer

Innhold. 1 Introduksjon... 17

Innhold. 1 Introduksjon... 17 Innhold 1 Introduksjon......................................... 17 Hva boken handler om........................................ 18 Et kjernepunkt: utforming av problemstilling................. 19 Nytten

Detaljer

Metodisk arbeid. Strukturert arbeidsmåte for å nå målet

Metodisk arbeid. Strukturert arbeidsmåte for å nå målet Metodisk arbeid Strukturert arbeidsmåte for å nå målet Strukturen Forarbeid - planleggingen Hvem, hva, hvor, når, hvorfor, hvordan.. Arbeid - gjennomføringen Utføre det planlagte operative arbeidet Etterarbeid

Detaljer

Effekten av styrketrening på sykkelprestasjonen

Effekten av styrketrening på sykkelprestasjonen Effekten av styrketrening på sykkelprestasjonen Sykkelprestasjon Olav Vikmoen Høgskolen i Lillehammer olav.vikmoen@hil.no Aerob energiomsetning (Performance VO2) Arbeidsøkonomi VO 2maks Utnyttingsgrad

Detaljer

SUBJEKTIV HELSE OG PSYKOSOSIALT ARBEIDSMILJØ I NORSK SIVIL LUFTFART

SUBJEKTIV HELSE OG PSYKOSOSIALT ARBEIDSMILJØ I NORSK SIVIL LUFTFART SUBJEKTIV HELSE OG PSYKOSOSIALT ARBEIDSMILJØ I NORSK SIVIL LUFTFART Mastergradsoppgave ved Universitetet i miljø- og biovitenskap - Mona Linge Tønnessen Veileder: Camilla Martha Ihlebæk Formålet med studien

Detaljer

RSK 001 Standard for forvaltningsrevisjon

RSK 001 Standard for forvaltningsrevisjon Forslag til revidert 06.10.10 RSK 001 Standard for forvaltningsrevisjon Innhold Avsnitt Innledning 1-5 Krav til revisor 6-9 Bestilling 10-11 Revisjonsdialogen 12-17 Prosjektplan 18-19 Problemstilling(er)

Detaljer

Kort overblikk over kurset sålangt

Kort overblikk over kurset sålangt Kort overblikk over kurset sålangt Kapittel 1: Deskriptiv statististikk for en variabel Kapittel 2: Deskriptiv statistikk for samvariasjon mellom to variable (regresjon) Kapittel 3: Metoder for å innhente

Detaljer

1. Introduksjon. I dag. MEVIT januar 2011 Tanja Storsul. MEVIT2800 og opplegget for våren.

1. Introduksjon. I dag. MEVIT januar 2011 Tanja Storsul. MEVIT2800 og opplegget for våren. 1. Introduksjon MEVIT2800 18. januar 2011 Tanja Storsul I dag MEVIT2800 og opplegget for våren. Syn på vitenskap og metode. Utforming av problemstillinger. Hva skiller vitenskap fra journalistikk? 1 MEVIT2800

Detaljer

Bruken av nasjonale prøver en evaluering

Bruken av nasjonale prøver en evaluering Bruken av nasjonale prøver en evaluering av poul skov, oversatt av Tore brøyn En omfattende evaluering av bruken av de nasjonale prøvene i grunnskolen1 viser blant annet at de er blitt mottatt positivt

Detaljer

SENSORVEILEDNING FOR DEN KVANTITATIVE DELEN AV EKSAMENSOPPGAVEN I SOS1002 HØSTEN 2006

SENSORVEILEDNING FOR DEN KVANTITATIVE DELEN AV EKSAMENSOPPGAVEN I SOS1002 HØSTEN 2006 SENSORVEILEDNING FOR DEN KVANTITATIVE DELEN AV EKSAMENSOPPGAVEN I SOS1002 HØSTEN 2006 Oppgave 1 Nedenfor ser du en forenklet tabell basert på informasjon fra den norske delen av European Social Survey

Detaljer

KLH 3002 Epidemiologi Eksamen Høst 2011 Eksaminator: Geir W. Jacobsen, ISM

KLH 3002 Epidemiologi Eksamen Høst 2011 Eksaminator: Geir W. Jacobsen, ISM KLH 3002 Epidemiologi Eksamen Høst 2011 Eksaminator: Geir W. Jacobsen, ISM Oppgaven består av 18 spørsmål, hvorav de første 15 er flervalgsspørsmål (ett poeng per oppgave) - sett ring rundt riktig svar.

Detaljer

Høye skårer indikerer høye nivåer av selvkontroll.

Høye skårer indikerer høye nivåer av selvkontroll. Psykologisk institutt PSY2012 Forskningsmetodologi III: Statistisk analyse, design og måling Eksamen vår 2015 Skriftlig skoleeksamen tirsdag 19. mai, 09:00 (4 timer) Resultater publiseres 10. juni Kalkulator

Detaljer

STUDIEÅRET 2014/2015. Utsatt individuell skriftlig eksamen. VTM 200- Vitenskapsteori og metode. Tirsdag 25. august 2015 kl. 10.00-12.00.

STUDIEÅRET 2014/2015. Utsatt individuell skriftlig eksamen. VTM 200- Vitenskapsteori og metode. Tirsdag 25. august 2015 kl. 10.00-12.00. STUDIEÅRET 2014/2015 Utsatt individuell skriftlig eksamen i VTM 200- Vitenskapsteori og metode Tirsdag 25. august 2015 kl. 10.00-12.00 Hjelpemidler: ingen Eksamensoppgaven består av 5 sider inkludert forsiden

Detaljer

Forfattere: Simon Magnus Mørland og Vilde Vig Bjune, Kuben videregående skole

Forfattere: Simon Magnus Mørland og Vilde Vig Bjune, Kuben videregående skole SPISS Naturfaglige artikler av elever i videregående opplæring Inneklima på soverom Forfattere: Simon Magnus Mørland og Vilde Vig Bjune, Kuben videregående skole I dette forsøket har vi tatt for oss soveroms-klimaet

Detaljer

Kapittel 3: Studieopplegg

Kapittel 3: Studieopplegg Oversikt over pensum Kapittel 1: Empirisk fordeling for en variabel o Begrepet fordeling o Mål for senter (gj.snitt, median) + persentiler/kvartiler o Mål for spredning (Standardavvik s, IQR) o Outliere

Detaljer

SKO OG BELASTNINGSLIDELSER. Kan vi gå oss inn i belastningslidelser? Terje Haugaa Miriam Kristiansen

SKO OG BELASTNINGSLIDELSER. Kan vi gå oss inn i belastningslidelser? Terje Haugaa Miriam Kristiansen SKO OG BELASTNINGSLIDELSER Kan vi gå oss inn i belastningslidelser? Terje Haugaa Miriam Kristiansen Mål for dagen Gjøre DEG i stand til å gjennomføre enkle tester av sko, og forstå betydningen av dette

Detaljer

SOS1120 Kvantitativ metode. Regresjonsanalyse. Lineær sammenheng II. Lineær sammenheng I. Forelesningsnotater 11. forelesning høsten 2005

SOS1120 Kvantitativ metode. Regresjonsanalyse. Lineær sammenheng II. Lineær sammenheng I. Forelesningsnotater 11. forelesning høsten 2005 SOS1120 Kvantitativ metode Regresjonsanalyse Forelesningsnotater 11. forelesning høsten 2005 Per Arne Tufte Lineær sammenheng I Lineær sammenheng II Ukelønn i kroner 4000 3500 3000 2500 2000 1500 1000

Detaljer

Individuell skriftlig eksamen. IBI 315- Fysiologisk adaptasjon til trening. Mandag 26. mai 2014 kl. 10.00-14.00. Hjelpemidler: kalkulator

Individuell skriftlig eksamen. IBI 315- Fysiologisk adaptasjon til trening. Mandag 26. mai 2014 kl. 10.00-14.00. Hjelpemidler: kalkulator BACHELOR I IDRETTSVITENSKAP MED SPESIALISERING I IDRETTSBIOLOGI 2013/2015 Individuell skriftlig eksamen IBI 315- Fysiologisk adaptasjon til trening i Mandag 26. mai 2014 kl. 10.00-14.00 Hjelpemidler: kalkulator

Detaljer

Aldring helse kroppsideal

Aldring helse kroppsideal Aldring helse kroppsideal - Et Smil(e)-arbeid utført av elever ved Skien videregående skole, Norge SMIL(e) arrangerte Science camp for lærere i Silkeborg fra 7. - 9. oktober 2012. Tema for campen var kreativitet.

Detaljer

Fysisk trening som del av helhetlig utvikling

Fysisk trening som del av helhetlig utvikling Fysisk trening som del av helhetlig utvikling Hans Åge S. Aandahl Fysioterapeut og fysisk trener ToppVolley Norge / NVBF Ullevål 2012 Hva kan forebygges? Bare uhell? Hvorfor forebygge idrettsskader? Idrettsskader

Detaljer

Smidighetstrening/Uttøying

Smidighetstrening/Uttøying Øvelsesutvalg LITT OM ØVELSENE Samtidig som bevegelighet kanskje er et av de viktigste momentene i håndball, er det kanskje også det momentet som det syndes mest mot. Vi er generelt alt for lite flinke

Detaljer

Målenivå: Kjønn: Alle bør kunne se at denne variabelen må plasseres på nominalnivå

Målenivå: Kjønn: Alle bør kunne se at denne variabelen må plasseres på nominalnivå Fasit til eksamen 30.november 000 Oppgave 1 a) Beskriv den avhengige og de uavhengige variablene i tabellen, og diskuter hvilket målenivå du vil gi de ulike variablene. MÅL: Test av studentens ferdigheter

Detaljer

Bevegelighetstrening. Mål med tøyning, myter eller fakta? Effekt av tøyning før og etter trening iht. muskelstølhet og skaderisiko.

Bevegelighetstrening. Mål med tøyning, myter eller fakta? Effekt av tøyning før og etter trening iht. muskelstølhet og skaderisiko. Bevegelighetstrening Idrettsfysioterapeut (MSc) og Personlig trener (EHFA) Leder fagavdelingen Montebellosenteret, Lillehammer Hva, hvordan og hvorfor Mål med tøyning, myter eller fakta? Forkorte restitusjonstid

Detaljer

Forespørsel om deltakelse i forskningsprosjektet

Forespørsel om deltakelse i forskningsprosjektet Forespørsel om deltakelse i forskningsprosjektet Effekten av karbohydrat og protein på utholdenhetsprestasjon ~18 timer etter en hard treningsøkt Bakgrunn og hensikt Dette er et spørsmål til deg om å delta

Detaljer

VEDLEGG 3 SJEKKLISTE FOR Å VURDERE KVALITATIV FORSKNING

VEDLEGG 3 SJEKKLISTE FOR Å VURDERE KVALITATIV FORSKNING 1 VEDLEGG 3 SJEKKLISTE FOR Å VURDERE KVALITATIV FORSKNING How do patients with exacerbated chronic obstructive pulmonary disease experience care in the intensive care unit (Torheim og Kvangarsnes, 2014)

Detaljer

Multisenterstudie. Frode Endresen. Manuellterapeut. Kvalitetssikring i klinikken, kollegaseminar, Trondheim 070313

Multisenterstudie. Frode Endresen. Manuellterapeut. Kvalitetssikring i klinikken, kollegaseminar, Trondheim 070313 Multisenterstudie Frode Endresen Manuellterapeut Kvalitetssikring i klinikken, kollegaseminar, Trondheim 070313 Multisenterstudie forskningsprosjekter som finner sted ved flere virksomheter samtidig og

Detaljer

Metodisk arbeid. Strukturert arbeidsmåte for å nå et bestemt mål

Metodisk arbeid. Strukturert arbeidsmåte for å nå et bestemt mål Metodisk arbeid Strukturert arbeidsmåte for å nå et bestemt mål Hva er en metode? En metode er et redskap, en fremgangsmåte for å løse utfordringer og finne ny kunnskap Metode kommer fra gresk, methodos:

Detaljer

Group-based parent-training programmes for improving emotional and behavioural adjustment in children from birth to three years old

Group-based parent-training programmes for improving emotional and behavioural adjustment in children from birth to three years old Group-based parent-training programmes for improving emotional and behavioural adjustment in children from birth to three years old Sammendrag fra pågående oppdatering av Cochrane-oversikt på oppdrag for

Detaljer

MASTER I IDRETTSVITENSKAP 2014/2016. Individuell skriftlig eksamen. STA 400- Statistikk. Fredag 13. mars 2015 kl. 10.00-12.00

MASTER I IDRETTSVITENSKAP 2014/2016. Individuell skriftlig eksamen. STA 400- Statistikk. Fredag 13. mars 2015 kl. 10.00-12.00 MASTER I IDRETTSVITENSKAP 2014/2016 Individuell skriftlig eksamen i STA 400- Statistikk Fredag 13. mars 2015 kl. 10.00-12.00 Hjelpemidler: kalkulator Eksamensoppgaven består av 10 sider inkludert forsiden

Detaljer

Treningslærekurs på NIAK

Treningslærekurs på NIAK Treningslærekurs på NIAK Emne: Bevegelighetstrening Av: Espen Tønnessen Hva er bevegelighet? Utøverens evne til bevegelsesutslag i ledd og leddkjeder Bevegeligheten kan måles i cm eller i grader Bevegeligheten

Detaljer

Sommertrenings program 2009/2010 Rælingen Håndballklubb Fellesskap Humør Utvikling

Sommertrenings program 2009/2010 Rælingen Håndballklubb Fellesskap Humør Utvikling Jenter 1994 Jenter 1993 Sommertrenings program 2009/2010 Rælingen Håndballklubb Fellesskap Humør Utvikling Innledning Egentrening er en viktig del av forberedelsene til en ny sesong. Et godt styrke og

Detaljer

FINN KEEPEREN I DEG!

FINN KEEPEREN I DEG! FINN KEEPEREN I DEG! Hei alle kolleger. NFF ønsker å forsterke fokus på de yngste keeperne. Finn keeperen i deg handler om at typer som passer til å spille i mål blir veiledet og stimulert av våre beste

Detaljer

Harbachelor-ogmasterstudenter ulikeoppfatningeravkvaliteti studieprogrammenesine?

Harbachelor-ogmasterstudenter ulikeoppfatningeravkvaliteti studieprogrammenesine? NOKUTssynteserogaktueleanalyser Harbachelor-ogmasterstudenter ulikeoppfatningeravkvaliteti studieprogrammenesine? SteinErikLid,juni2014 Datagrunnlaget for Studiebarometeret inkluderer en rekke bakgrunnsvariabler

Detaljer

Hvordan Kunnskapsesenterets

Hvordan Kunnskapsesenterets Foredrag på seminaret Rehabilitering av brystkreftpasienter, 11. mars 2009 Hvordan Kunnskapsesenterets jobber vi med en systematisk nye PPT-mal oversikt Lene K. Juvet, (prosjektleder) Forsker, PhD. Hvorfor

Detaljer

H 12 Eksamen PED 3008 Vitenskapsteori og forskningsmetode

H 12 Eksamen PED 3008 Vitenskapsteori og forskningsmetode H 12 Eksamen PED 3008 Vitenskapsteori og forskningsmetode Innlevering Eksamensbesvarelsen i PED3008 består av en individuell semesteroppgave i vitenskapsteori og forskningsmetode (teller 2/3 av endelig

Detaljer

Vurdering av kvaliteten på undersøkelser om virkninger av trafikksikkerhetstiltak

Vurdering av kvaliteten på undersøkelser om virkninger av trafikksikkerhetstiltak Sammendrag: Vurdering av kvaliteten på undersøkelser om virkninger av trafikksikkerhetstiltak TØI-rapport 984/2008 Forfatter(e): Rune Elvik Oslo 2008, 140 sider Denne rapporten presenterer en undersøkelse

Detaljer

De 60 som også var til 2-uker oppfølgingsopphold ca 6mnd etter det første (3-

De 60 som også var til 2-uker oppfølgingsopphold ca 6mnd etter det første (3- Effekt av Skogliopphold for pasienter med overvektsproblematikk Resultat av rehabiliteringsopphold målt ved avreise, ved 6mnd- og 12 mndoppfølgingsopphold og brevoppfølging 1 år etter opphold. Tidsperiode:

Detaljer

Oppgave 1. Det oppgis at dersom y ij er observasjon nummer j fra laboratorium i så er SSA = (y ij ȳ i ) 2 = 3.6080.

Oppgave 1. Det oppgis at dersom y ij er observasjon nummer j fra laboratorium i så er SSA = (y ij ȳ i ) 2 = 3.6080. EKSAMEN I: MOT310 STATISTISKE METODER 1 VARIGHET: 4 TIMER DATO: 28. FEBRUAR 2005 TILLATTE HJELPEMIDLER: KALKULATOR, TABELLER OG FORMLER I STATISTIKK (TAPIR FORLAG) OPPGAVESETTET BESTÅR AV 4 OPPGAVER PÅ

Detaljer

Forelesningsplan for emnet undervisningsemnet, GERSYK4302 Metode (10sp), høst 2012/vår 2013

Forelesningsplan for emnet undervisningsemnet, GERSYK4302 Metode (10sp), høst 2012/vår 2013 Forelesningsplan for emnet undervisningsemnet, GERSYK4302 Metode (10sp), høst 2012/vår 2013 Metode høst 2012/vår 2013 Hensikten med metodekurset er å gi en oversikt over ulike forskningsmetoder, med presentasjon

Detaljer

EKSAMEN I SOS1120 KVANTITATIV METODE 23. NOVEMBER 2004 (6 timer)

EKSAMEN I SOS1120 KVANTITATIV METODE 23. NOVEMBER 2004 (6 timer) EKSAMEN I SOS20 KVANTITATIV METODE 23. NOVEMBER 2004 (6 timer) Bruk av ikke-programmerbar kalkulator er tillatt under eksamen. Utover det er ingen hjelpemidler tillatt. Sensur faller tirsdag 4. desember

Detaljer

Eksempel på digital løsning

Eksempel på digital løsning UiO Institutt for Helse og Samfunn Universitetet i Oslo Eksempel på digital løsning Hanne Dagfinrud Utvikling av kjernesett Fysisk inaktivitet er en av de største helse problemene i verden (Blair 2009)

Detaljer

+ S2 Y ) 2. = 6.737 6 (avrundet nedover til nærmeste heltall) n Y 1

+ S2 Y ) 2. = 6.737 6 (avrundet nedover til nærmeste heltall) n Y 1 Løsningsforslag for: MOT10 STATISTISKE METODER 1 VARIGHET: 4 TIMER DATO: 6. november 007 TILLATTE HJELPEMIDLER: Kalkulator: HP0S, Casio FX8 eller TI-0 Tabeller og formler i statistikk (Tapir forlag) MERKNADER:

Detaljer

Kvalitativ metode. Kvalitativ metode. Kvalitativ metode. Kvalitativ metode. Forskningsprosessen. Forelesningen

Kvalitativ metode. Kvalitativ metode. Kvalitativ metode. Kvalitativ metode. Forskningsprosessen. Forelesningen 9. februar 2004 Forelesningen Metode innenfor samfunnsvitenskap og humaniora: Vi studerer en fortolket verden: oppfatninger, verdier, normer - vanskelig å oppnå objektiv kunnskap Metodisk bevissthet: Forstå

Detaljer

Innhold. Forord Del 1 UTFORMING AV UNDERSØKELSEN... 13

Innhold. Forord Del 1 UTFORMING AV UNDERSØKELSEN... 13 Innhold Forord... 11 Del 1 UTFORMING AV UNDERSØKELSEN... 13 Kapittel 1 Metode og vitenskapsteori... 15 1.1 Innledning... 15 1.2 To ulike tilnærmingsmåter: Positivisme vs. fortolkning/konstruktivisme..

Detaljer

Samfunnsvitenskapelig metode innføring

Samfunnsvitenskapelig metode innføring Samfunnsvitenskapelig metode innføring Forelesning 28/8 2014 Formål og pensum Kjenne til grunnleggende begreper og teknikker i samfunnsvitenskapelig metode Kunne anvende teknikkene i arbeidet med masteroppgaven

Detaljer

«State of the art» knyttet til effektive tiltak innen fysisk aktivitet

«State of the art» knyttet til effektive tiltak innen fysisk aktivitet «State of the art» knyttet til effektive tiltak innen fysisk aktivitet KreftREHAB 28.april 2017 Lene Thorsen Nasjonal kompetansetjeneste for seneffekter etter kreft, Avdeling for kreftbehandling og Avdeling

Detaljer

Drikkevaner mellom jenter og gutter

Drikkevaner mellom jenter og gutter Drikkevaner mellom jenter og gutter I undersøkelsen vår ville vi finne ut om det fantes noen forskjell på alkoholbruken blant unge jenter og gutter på Horten Videregående skole. Vi har tatt med en del

Detaljer

Trener 1 kurs 2. Utgave 13. januar 2014

Trener 1 kurs 2. Utgave 13. januar 2014 Trener 1 kurs 2. Utgave 13. januar 2014 1) Skjelettet - 2) Nervesystemet - 3) Det kardiovaskulære systemet (Hjerte og blodårer) 4-5) Ulike organsystemer: fordøyelse og åndedrett 6) Muskler og ligamenter

Detaljer

6.2 Signifikanstester

6.2 Signifikanstester 6.2 Signifikanstester Konfidensintervaller er nyttige når vi ønsker å estimere en populasjonsparameter Signifikanstester er nyttige dersom vi ønsker å teste en hypotese om en parameter i en populasjon

Detaljer

Rapport Effekt av nevrosensomotorisk trening. Oppsummering av eksperiment i perioden 30. april 3. juni 2016

Rapport Effekt av nevrosensomotorisk trening. Oppsummering av eksperiment i perioden 30. april 3. juni 2016 Rapport Effekt av nevrosensomotorisk trening Oppsummering av eksperiment i perioden 30. april 3. juni 2016 Dato Versjon Forfattere Kommentar 24.06.2016 1.0 Monika L. Eknes, Første utgave av rapport Beate

Detaljer

Oppgave 1. T = 9 Hypotesetest for å teste om kolesterolnivået har endret seg etter dietten: T observert = 2.16 0

Oppgave 1. T = 9 Hypotesetest for å teste om kolesterolnivået har endret seg etter dietten: T observert = 2.16 0 Løsningsforslag til eksamen i MOT310 STATISTISKE METODER 1 VARIGHET: 4 TIMER DATO: 08. mai 2008 TILLATTE HJELPEMIDLER: Kalkulator: HP30S, Casio FX82 eller TI-30 Tabeller og formler i statistikk (Tapir

Detaljer

Digitaltesten 2 - en diagnostisk test. Ellen Gard

Digitaltesten 2 - en diagnostisk test. Ellen Gard Digitaltesten 2 - en diagnostisk test Digitaltesten Et samarbeidsprosjekt mellom Vox og Norsk Test AS Vox tildeler tester og sertifiserer tilbydere Norsk Test drifter testen fra sin server Test Test =

Detaljer

FORSKNINGSMETODE NOEN GRUNNLEGGENDE KONSEPTER

FORSKNINGSMETODE NOEN GRUNNLEGGENDE KONSEPTER INF1500 H 2015 Magnus Li NOEN GRUNNLEGGENDE KONSEPTER VITENSKAPELIG METODE Hva? - Som vi har sett har mennesket en persepsjon som er gjennstand for subjektivitet og snarveier. For å kunne finne ut hva

Detaljer

DET HUMANISTISKE FAKULTET MASTEROPPGAVE. Forfatter: Inger Johanne Lund Strømland (signatur forfatter)

DET HUMANISTISKE FAKULTET MASTEROPPGAVE. Forfatter: Inger Johanne Lund Strømland (signatur forfatter) DET HUMANISTISKE FAKULTET MASTEROPPGAVE Studieprogram: Master i Spesialpedagogikk Høstsemesteret 2012 Åpen Forfatter: Inger Johanne Lund Strømland (signatur forfatter) Veileder: Ella Maria Cosmovici Idsøe

Detaljer

NSH konferanse 19. september, Hilde Sylliaas, postdoc Kavlifondet og førsteamanuensis HiOA

NSH konferanse 19. september, Hilde Sylliaas, postdoc Kavlifondet og førsteamanuensis HiOA NSH konferanse 19. september, 2012 Hilde Sylliaas, postdoc Kavlifondet og førsteamanuensis HiOA Eldre har fysiologiske endringer i muskulatur som gir: Redusert evne til å utføre raske bevegelser Redusert

Detaljer

Eksamensoppgave i (emnekode) (emnenavn)

Eksamensoppgave i (emnekode) (emnenavn) Institutt for (instituttnavn) Eksamensoppgave i (emnekode) (emnenavn) Faglig kontakt under eksamen: Tlf.: Eksamensdato: Eksamenstid (fra-til): Hjelpemiddelkode/Tillatte hjelpemidler: Annen informasjon:

Detaljer

EKSAMEN I FAG TMA4255 ANVENDT STATISTIKK

EKSAMEN I FAG TMA4255 ANVENDT STATISTIKK Norges teknisk naturvitenskapelige universitet Institutt for matematiske fag Side 1 av 5 Faglig kontakt under eksamen: Bo Lindqvist Tlf. 975 89 418 BOKMÅL EKSAMEN I FAG TMA4255 ANVENDT STATISTIKK Onsdag

Detaljer

STUDIEÅRET 2014/2015. Individuell skriftlig eksamen i STA 200- Statistikk. Torsdag 16. april 2015 kl. 10.00-12.00

STUDIEÅRET 2014/2015. Individuell skriftlig eksamen i STA 200- Statistikk. Torsdag 16. april 2015 kl. 10.00-12.00 STUDIEÅRET 2014/2015 Individuell skriftlig eksamen i STA 200- Statistikk Torsdag 16. april 2015 kl. 10.00-12.00 Hjelpemidler: kalkulator. Formelsamling blir delt ut på eksamen Eksamensoppgaven består av

Detaljer

Prosjektplan. Atle Grov - 110695 Willy Gabrielsen - 110713 Einar tveit - 110804

Prosjektplan. Atle Grov - 110695 Willy Gabrielsen - 110713 Einar tveit - 110804 Prosjektplan Atle Grov - 110695 Willy Gabrielsen - 110713 Einar tveit - 110804 Økonomi og ledelse 2011-2014 Innholdsfortegnelse 1. Innledning Side 1 2. Organisering 2.1 Gruppen 2.2 Veileder 2.3 Ressurspersoner

Detaljer

SJEKKLISTE FOR VURDERING AV FOREKOMSTSTUDIE

SJEKKLISTE FOR VURDERING AV FOREKOMSTSTUDIE SJEKKLISTE FOR VURDERING AV FOREKOMSTSTUDIE (Tverrsnittstudie, spørreundersøkelse, survey) FØLGENDE FORHOLD MÅ VURDERES: Kan vi stole på resultatene? Hva forteller resultatene? Kan resultatene være til

Detaljer

Oppgave 1. Besvarelse av oppgave 1c) Mål på statistisk sammenheng mellom variabler i krysstabeller

Oppgave 1. Besvarelse av oppgave 1c) Mål på statistisk sammenheng mellom variabler i krysstabeller Oppgave 1 a) Beskriv den avhengige og de uavhengige variablene i tabellen, og diskuter hvilket målenivå du vil gi de ulike variablene. b) Forklar kort hva tabellen viser. c) Hva er korrelasjonen mellom

Detaljer

Norges Skøyteforbund. Styrke-, spenst-, hurtighets- og utholdenhetstrening

Norges Skøyteforbund. Styrke-, spenst-, hurtighets- og utholdenhetstrening Norges Skøyteforbund Styrke-, spenst-, hurtighets- og utholdenhetstrening Muskelarbeid Utvikling av kraft Utvikling av kraft kan skje når muskelen forkortes, holder en stilling eller forlenges Kraften

Detaljer

Grunnleggende statistikk. Eva Denison 25. Mai 2016

Grunnleggende statistikk. Eva Denison 25. Mai 2016 Grunnleggende statistikk Eva Denison 25. Mai 2016 Agenda Hva er statistikk, og hvorfor trenger vi det? Beskrivende statistikk Statistisk analyse Meta-analyse Hva er statistikk? En måte å kvantitativt beskrive

Detaljer

Verktøy for design av forvaltningsrevisjonsprosjekter

Verktøy for design av forvaltningsrevisjonsprosjekter Verktøy for design av forvaltningsrevisjonsprosjekter Nasjonal fagkonferanse i offentlig revisjon 17-18 oktober 2006 Lillin Cathrine Knudtzon og Kristin Amundsen DESIGNMATRISE HVA HVOR- DAN GJENNOMFØR-

Detaljer