Arabidopsis thaliana, vårskrinneblom

Save this PDF as:
 WORD  PNG  TXT  JPG

Størrelse: px
Begynne med side:

Download "Arabidopsis thaliana, vårskrinneblom"

Transkript

1 Arabidopsis thaliana, vårskrinneblom Tilhører Brassicaceae familien og ligger under ordenen Capparales. Nært beslektede planter er f. eks. raps og kål. Arabidopsis thaliana har i flere år vært en av modell organismene innen plante biologi. Dette er på grunn av flere faktorer. Arabidopsis thaliana har en kort livssyklus, ca. 6 uker i fra spiring til den utvikler modne frø. Den er enkel å dyrke, er liten av vekst (ca. 30 cm høy), og trenger lite dyrkningsplass. Arabidopsis thaliana er en selv-pollinator, dvs. en trenger ikke manuelt å pollinere blomstene (ev. være avhengig av insekt pollinatorer). Kryss-pollinering er også relativt sjelden. Det er derfor lett å få rene linjer. Den lar seg lett transformere med Agrobacterium tumefaciens som kan overføre ulike gen-konstruksjoner.

2 Den er diploid og har et genom på ca. 125 mega baser. Inneholder lite repetert DNA og i over 10 år har det eksistert relativt gode genetiske kart. Det finnes et stort utvalg av Arabidopsis mutanter som kan fås i fra frøbanker / Stock center i USA og England.

3 Arabidopsis ble i Desember 2000 den første planten hvor hele genomet (minus enkelte centromer regioner) ble oppklart / sekvensert. Arabidopsis genomet består av 5 kromosom som varierer i fra 17.5 til 29.1 mega baser. Sekvenseringen av Arabidopsis ble foretatt av et internasjonalt konsortium The Arabidopsis Genome Initiative i tidsrommet Mesteparten ble sekvensert de siste 2 årene.

4 På grunn av at gode genetiske kart eksisterte for Arabidopsis og at genomet var relativt lite ble en mapping basert sekvenseringsstrategi benyttet. Dvs. det ble laget et genomisk BAC bibliotek, hvor overlappende kloner ble identifisert ved hjelp av RFLP analyser og hybridisering eller ved PCR av sequencetagged sites (STS) og Southern blotting. BAC kloner ble deretter shotgun sekvensert. Dvs. BAC klonene (ca kb.) ble enkeltvis kuttet opp i småbiter og klonet over i plasmid vektorer (1-3 Kb) og deretter sekvensert. Overlappende sekvenser ble deretter satt sammen til sekvens av hele BAC klon var komplett.

5 Resultatet fra sekvenseringen viste at Arabidopsis thaliana genomet var rundt 125 mega baser og inneholdt rundt 25,000 gener. Dvs. flere gener enn man fant i de to invertebrate organismene; nematoden Caenorhabditis elegans (ca. 19,000 gener) og i bananflua Drosophila melanogaster (ca. 13,500 gener). Selv om sekvensen til genomet er kjent er det fremdeles mye arbeid som gjenstår. Å sette sammen alle exon i et gen korrekt, samt å finne start / stopp og beskrivelse av protein er ikke trivielt. Denne prosessen, som kalles for annotering, er i mange tilfeller gjort av dataprogram og er ofte unøyaktig. Etter at dataprogrammet har funnet et mulig gen og korresponderende protein blir disse sjekket mot gen / protein databasene: GenBank, Pfam osv. Protein sekvens. >gi gb AAB MDHNSPKSRRSRKPEPKPDIYSTFVVHSDSDSDQGRDRDKRKAKPEEDENVDLYATMVYKGDSDGEGEED DDDDSMLPPLLKRLPKDFGGGASLDYDDDDGDESGDFGTMIVKTDRSSHSKKNSPYSSKPRMGVSPRRRA RGGDEESSDEEDEEEDDDDDDGDYGTFVVKSKDKKGKKKDKEIDMTTMGRAVASMQKSNFGGKTRKLDPS SSSSKLHGEDNRKMQQQNSKMSTTSLPDSITREDPTTKYEFLNELGKGSYGSVYKARDLKTSEIVAVKVI SLTEGEEGYEEIRGEIEMLQQCNHPNVVRYLGSYQGEDYLWIVMEYCGGGSVADLMNVTEEALEEYQIAY ICREALKGLAYLHSIYKVHRDIKGGNILLTEQGEVKLGDFGVAAQLTRTMSKRNTFIGTPHWMAPEVIQE NRYDGKVDVWALGVSAIEMAEGLPPRSSVHPMRVLFMISIEPAPMLEDKEKWSLVFHDFVAKCLTKEPRL RPTAAEMLKHKFVERCKTGASAMSPKIEKSRQIRATMALQAQSVVAPSLEDTSTLGPKSSEELGITVPSK PPQNSTEAPLTSTLNRQHITGNTVLAGEGGDFGTMIVHGEDETEESDSRSQLVREKESSSSQFEGVPREF PGEELPDSWIHDKKKPPAIDLPVEASISQSMQASSSHEHRTKLHNIAGTQMEGGSDASGSTLKNETVGRK AFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNGTVAVEALQELFTSSDPQSKKGR RGQNEMPLPPSVYQRLTTSSSLMNLAQVLAYHRACYEEMPLQELQATQEQQTIQNLCDTLRTILRL BlastP analyse. Sequences producing significant alignments: Score E Value gi gb AAB (U96613) serine/threonine kinase gi gb AAG (AY013245) 36I5.3 [Oryza sativa] gi gb AAC kinase [Dictyostelium discoideum] e-74 gi gb AAF CG7097 [Drosophila melanogaster] e-71 gi sp O00506 ST25_HUMAN SERINE/THREONINE PROTEIN K e-71

6 Kun 9% av genene i Arabidopsis thaliana er annotert og karakterisert eksperimentelt (ikke maskinelt). Nesten 40% av genene er uklassifiserte, hypotetiske, ukjente.

Sammenligningen mellom Arabidopsis thaliana genomet og de kjente genomene fra cyanobakterier, gjær, bananflue og nematode, viser bl. a.

Sammenligningen mellom Arabidopsis thaliana genomet og de kjente genomene fra cyanobakterier, gjær, bananflue og nematode, viser bl. a. Sammenligningen mellom Arabidopsis thaliana genomet og de kjente genomene fra cyanobakterier, gjær, bananflue og nematode, viser bl. a. Antall gener som er involvert i cellulær kommunikasjon og signaloverføring

Detaljer

Oversikt over kap.10. Kap 10. Rekonstruksjon av Genomet. Splitt og overvinn strategien imøtekommer de fleste utfordringer

Oversikt over kap.10. Kap 10. Rekonstruksjon av Genomet. Splitt og overvinn strategien imøtekommer de fleste utfordringer Kap 10. Rekonstruksjon av Genomet Gjennom genetisk og molekylær analyse Oversikt over kap.10 Utfordringer og strategier ved genomanalyse Genomstørrelse Egenskaper må også analyseres Problemer med DNA polymorfismer

Detaljer

UNIVERSITETET I OSLO

UNIVERSITETET I OSLO UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet Eksamen i : INF2300 Grunnkurs i bioinformatikk Eksamensdag : Tirsdag 15. juni 2004 Tid for eksamen : 09.00 12.00 Oppgavesettet er på : 13

Detaljer

FYS3710 Molekylærbiologi

FYS3710 Molekylærbiologi 1 2 I en eukaryot celle er kromosomene festet i en indre membran som omgir en kjerne. Proteinene produseres i cellens cytoplasma. 3 I en prokaryot celle (for eksempel en bakteriecelle) er det ett kromosom.

Detaljer

LEKSJON 4: BIOTEKNOLOGI HVORDAN VI BRUKER NATURENS EGNE MEKANISMER TIL VÅR FORDEL, OG UTFORDRINGENE SOM FØLGER MED

LEKSJON 4: BIOTEKNOLOGI HVORDAN VI BRUKER NATURENS EGNE MEKANISMER TIL VÅR FORDEL, OG UTFORDRINGENE SOM FØLGER MED LEKSJON 4: BIOTEKNOLOGI HVORDAN VI BRUKER NATURENS EGNE MEKANISMER TIL VÅR FORDEL, OG UTFORDRINGENE SOM FØLGER MED KOMPETANSEMÅL Forklarebegrepene krysning og genmodifisering, og hvordan bioteknologi brukes

Detaljer

Den komplette DNA sekvens fra en organisme.

Den komplette DNA sekvens fra en organisme. Definisjoner: Hva er et genom? Den komplette DNA sekvens fra en organisme. Den komplette samlingen av gener som koder for alle proteiner, pluss ribosomalt RNA, trna, snrna (involvert i mrna spleising)

Detaljer

Genkartlegging. Hva er egentlig et genkart? Genetisk og fysisk kartlegging

Genkartlegging. Hva er egentlig et genkart? Genetisk og fysisk kartlegging NTNU Genkartlegging 1 Termin IC Frank Skorpen Institutt for laboratoriemedisin, barne- og kvinnesykdommer Hva er egentlig et genkart? Kartet over det humane genom gir oss posisjonen av de ca 25,000 genene

Detaljer

Kapittel 14: Det eukaryote genom og dets uttrykksregulering

Kapittel 14: Det eukaryote genom og dets uttrykksregulering Kapittel 14: Det eukaryote genom og dets uttrykksregulering Innhold: 1. Det humane genom 2. Struktur av protein-kodende gener 3. RNA processering 4. Transkripsjonell kontroll 5. Posttranskripsjonell kontroll

Detaljer

Oversikt over kap. 11. Kap. 11 Den direkte påvisning av genotype skiller individuelle genomer. Fire klasser av DNA polymorfismer.

Oversikt over kap. 11. Kap. 11 Den direkte påvisning av genotype skiller individuelle genomer. Fire klasser av DNA polymorfismer. Kap. 11 Den direkte påvisning av genotype skiller individuelle genomer Oversikt over kap. 11 Fire klasser av DNA variasjon til direkte påvisning av genotype. Metoder som bruker hybridisering, elektroforese,

Detaljer

UNIVERSITETET I OSLO

UNIVERSITETET I OSLO UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet Eksamen i : INF2300 Grunnkurs i bioinformatikk Eksamensdag : Mandag 6. juni 2005 Tid for eksamen : 09.00 12.00 Oppgavesettet er på : xx

Detaljer

FLERVALGSOPPGAVER BIOTEKNOLOGI

FLERVALGSOPPGAVER BIOTEKNOLOGI FLERVALGSOPPGAVER BIOTEKNOLOGI FLERVALGSOPPGAVER FRA EKSAMEN I BIOLOGI 2 V2008 - V2011 Disse flervalgsoppgavene er hentet fra eksamen i Biologi 2 del 1. Det er fire (eller fem) svaralternativer i hver

Detaljer

Figurer kapittel 8: Bioteknologi Figur s

Figurer kapittel 8: Bioteknologi Figur s 2 Figurer kapittel 8: Bioteknologi Figur s. 236 237 5' 3' 5' 3' DNA-primer 5' 3' DNA bit som skal kopieres Oppvarming 3' 5' 5' DNAprimer tilsettes 3' 3' 5' DNApolymerase Nytt DNA dannes Kopieringen gjentas

Detaljer

Hva GMO er, utbredelse og forventede nye produkter. Professor Hilde-Gunn O Hoen-Sorteberg

Hva GMO er, utbredelse og forventede nye produkter. Professor Hilde-Gunn O Hoen-Sorteberg Hva GMO er, utbredelse og forventede nye produkter Professor Hilde-Gunn O Hoen-Sorteberg Inst. Plante & Miljøvitenskap (IPM) Universitetet for Miljø & Biovitenskap (UMB) 1 Vitenskapskomiteen for mattrygghet

Detaljer

Et virus assosiert med HSMB er kartlagt. Del 2: Metodikk og potensiale. Torstein Tengs

Et virus assosiert med HSMB er kartlagt. Del 2: Metodikk og potensiale. Torstein Tengs Et virus assosiert med HSMB er kartlagt. Del 2: Metodikk og potensiale Torstein Tengs Ukjente patogener I alle systemer finnes det sykdommer hvor man mistenker et infektiøst agens, men hvor dette ikke

Detaljer

Genressurser i moderne planteforedling og forskning

Genressurser i moderne planteforedling og forskning Genressurser i moderne planteforedling og forskning Odd Arne Rognli, Institutt for plantevitenskap, NMBU 03.09.2015 Kilde: Petter Marum, Graminor Kilde: Petter Marum, Graminor Kilde: Petter Marum, Graminor

Detaljer

UNIVERSITETET I OSLO

UNIVERSITETET I OSLO Bokmål UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet Eksamen i : INF2300 Grunnkurs i bioinformatikk Eksamensdag : Mandag 6. juni 2005 Tid for eksamen : 09.00 12.00 Oppgavesettet er på

Detaljer

Metode for å kartlegge DNA-et og båndmønsteret det har. Brukes for å kartlegge slektskap eller identifisere individer innenfor rettsmedisin.

Metode for å kartlegge DNA-et og båndmønsteret det har. Brukes for å kartlegge slektskap eller identifisere individer innenfor rettsmedisin. 8: Den bioteknologiske tidsalderen Figur side 238 Proteiner fra olje og gass Bryggerier Meierivirksomhet Næringsmiddelindustri Fiskeavl Akvakultur Genmodifiserte organismer Planteavl Landbruk Husdyravl

Detaljer

EKSAMENSOPPGAVE I BI2014 MOLEKYLÆRBIOLOGI

EKSAMENSOPPGAVE I BI2014 MOLEKYLÆRBIOLOGI Norges teknisk-naturvitenskapelige universitet Institutt for biologi EKSAMENSOPPGAVE I BI014 MOLEKYLÆRBIOLOGI Faglig kontakt under eksamen: Ralph Kissen Tlf.: 41344134 (mobil) - Eksamensdato: 11. desember

Detaljer

Kosmos SF. Figurer kapittel 8 Den biologiske tidsalderen Figur s. 214 BIOTEKNOLOGI. Næringsmiddelindustri. Landbruk. Akvakultur

Kosmos SF. Figurer kapittel 8 Den biologiske tidsalderen Figur s. 214 BIOTEKNOLOGI. Næringsmiddelindustri. Landbruk. Akvakultur Figurer kapittel 8 Den biologiske tidsalderen Figur s. 214 Proteiner fra olje og gass Bryggerier Meierivirksomhet Næringsmiddelindustri Fiskeavl Akvakultur Genmodifiserte organismer Planteavl Landbruk

Detaljer

Dypsekvensering. Next generation sequencing (NGS) High throughput sequencing (HTS)

Dypsekvensering. Next generation sequencing (NGS) High throughput sequencing (HTS) Dypsekvensering Next generation sequencing (NGS) High throughput sequencing (HTS) Bioingeniørkongressen 03.06.2016 Eidi Nafstad Avdelingsingeniør Avdeling for medisinsk genetikk, OUS Kromosomer og DNA

Detaljer

Kosmos SF. Figurer kapittel 8: Den bioteknologiske tidsalderen Figur s. 234 BIOTEKNOLOGI. Næringsmiddelindustri. Landbruk.

Kosmos SF. Figurer kapittel 8: Den bioteknologiske tidsalderen Figur s. 234 BIOTEKNOLOGI. Næringsmiddelindustri. Landbruk. Figurer kapittel 8: Den bioteknologiske tidsalderen Figur s. 234 Proteiner fra olje og gass Bryggerier Meierivirksomhet Næringsmiddelindustri Fiskeavl Akvakultur Genmodifiserte organismer Planteavl Landbruk

Detaljer

Hvordan standardisere en metode for isolering av plasmid til syntese av diabetes antigener?

Hvordan standardisere en metode for isolering av plasmid til syntese av diabetes antigener? Hvordan standardisere en metode for isolering av plasmid til syntese av diabetes antigener? Ranveig Østrem, Bioingeniør Hormonlaboratoriet, Aker Oslo Universitetssykehus Bakgrunn for analysen Pasienter

Detaljer

Bioteknologi i dag muligheter for fremtiden

Bioteknologi i dag muligheter for fremtiden Bioteknologi i dag muligheter for fremtiden Arvestoff Genetisk materiale, DNA. Baser En del av et nukleotid som betegnes med bokstavene A, C, G og T. Med disse fire bokstavene skriver DNAtrådene sine beskjeder

Detaljer

Faglig kontaktperson under eksamen: 1.aman. Hans K. Stenøien ( )

Faglig kontaktperson under eksamen: 1.aman. Hans K. Stenøien ( ) Side 1 av 11 Norges teknisknaturvitenskapelige universitet Fakultet for naturvitenskap og teknologi Institutt for biologi Faglig kontaktperson under eksamen: 1.aman. Hans K. Stenøien (91897592) EKSAMEN

Detaljer

Organismer med strekkoder artsbestemming med DNA-sekvenser

Organismer med strekkoder artsbestemming med DNA-sekvenser Torbjørn Ekrem og Bjarte H. Jordal Organismer med strekkoder artsbestemming med DNA-sekvenser Tenk deg at du er på tur i skogen, kanskje med en skoleklasse på slep, og finner en plante eller et dyr som

Detaljer

EKSAMENSOPPGAVE I BI2015 Molekylærbiologi laboratoriekurs

EKSAMENSOPPGAVE I BI2015 Molekylærbiologi laboratoriekurs Norges teknisk-naturvitenskapelige universitet Institutt for biologi EKSAMENSOPPGAVE I BI2015 Molekylærbiologi laboratoriekurs Faglig kontakt under eksamen: Ole Petter Thangstad og Anders Øverby Tlf.:

Detaljer

Kap 12. Det eukaryote kromosom. En organelle for pakking og styring av DNA

Kap 12. Det eukaryote kromosom. En organelle for pakking og styring av DNA Kap 12. Det eukaryote kromosom En organelle for pakking og styring av DNA Oversikt over kapittel 12 Komponentene i et kromosom: DNA, histoner, og nonhiston proteiner Ett langt DNA molekyl og mange typer

Detaljer

Foreleser: Eivind Coward, kontor 5. etg. Datablokken. coward@ii.uib.no Gruppeleder: Harald Barsnes

Foreleser: Eivind Coward, kontor 5. etg. Datablokken. coward@ii.uib.no Gruppeleder: Harald Barsnes Foreleser: Eivind Coward, kontor 5. etg. Datablokken. coward@ii.uib.no Gruppeleder: Harald Barsnes Forelesninger: tirsdag og fredag 12 14 rom 2104 Øvinger: fredag 10 12 rom 2143 Gi en innføring i noen

Detaljer

Populasjonsgenomikk på torsk -et verktøy for identifisering av viktige genomiske regioner for oppdrettsnæringen.

Populasjonsgenomikk på torsk -et verktøy for identifisering av viktige genomiske regioner for oppdrettsnæringen. Programkonferansen HAVBRUK 2012, Stavanger, 16.-18. april 2012 Populasjonsgenomikk på torsk -et verktøy for identifisering av viktige genomiske regioner for oppdrettsnæringen. Paul R. Berga, Bastiaan Stara,

Detaljer

Oppgave 2b V1979 Hvor i cellen foregår proteinsyntesen, og hvordan virker DNA og RNA i cellen under proteinsyntesen?

Oppgave 2b V1979 Hvor i cellen foregår proteinsyntesen, og hvordan virker DNA og RNA i cellen under proteinsyntesen? Bi2 «Genetikk» [3B] Målet for opplæringa er at elevane skal kunne gjere greie for transkripsjon og translasjon av gen og forklare korleis regulering av gen kan styre biologiske prosessar. Oppgave 2b V1979

Detaljer

Zebrafish as a model for human development and disease. Jon Vidar Helvik

Zebrafish as a model for human development and disease. Jon Vidar Helvik Zebrafish as a model for human development and disease. Jon Vidar Helvik Mann versus fish Zebrafish is an important model for human development and disease. Most human organ system can be study on a cellular

Detaljer

BIOS 2 Biologi

BIOS 2 Biologi . BIOS 2 Biologi..... 2..................................... Figurer kapittel 7: Bioteknologi Figur s. 220 Mikroorganisme Virus Bakterier Parasitter Sykdommer Hepatitt og B, Herpes simplex, rabies, hiv

Detaljer

PBM 233 Mikrobiologi for farmasøyter

PBM 233 Mikrobiologi for farmasøyter PBM 233 Mikrobiologi for farmasøyter Faglærer 2004: Per Arne Risøen Biologisk seksjon, ZEB Kap. 11 Mikrobiell evolusjon og systematikk Dateringer av fossiler viser at bakterier oppstod for ca. 3,6 milliarder

Detaljer

Hfr-stammer Kartlegging ved avbrutt konjugasjon (time of entry)

Hfr-stammer Kartlegging ved avbrutt konjugasjon (time of entry) BAKTERIE OG FAG GENETIKK Man studerer ofte E. coli fordi den inneholder få gener (4700 kb)sammenlihgnet med menneskets ca 6 mill kb, har kort generasjonstid (20 min) og er hele livssyklusen i haploid tilstand.

Detaljer

Problembakterier karakterisering og genotyping. André Ingebretsen Avdeling for smittevern og Avdeling for mikrobiologi Oslo universitetssykehus

Problembakterier karakterisering og genotyping. André Ingebretsen Avdeling for smittevern og Avdeling for mikrobiologi Oslo universitetssykehus Problembakterier karakterisering og genotyping André Ingebretsen Avdeling for smittevern og Avdeling for mikrobiologi Oslo universitetssykehus Mikroorganismer finnes i alle miljøer? Estimat av biodiversitet

Detaljer

Mer om gensøk. Kjapp oppsummering fra sist gang. Motif eller tilfeldig DNA forts. Motif eller tilfeldig DNA? Forelesning INF3350/

Mer om gensøk. Kjapp oppsummering fra sist gang. Motif eller tilfeldig DNA forts. Motif eller tilfeldig DNA? Forelesning INF3350/ Mer om gensøk Kjapp oppsummering fra sist gang Forelesning INF3350/4350 12. sept 2007 Ole Christian Lingjærde Gruppen for bioinformatikk Institutt for Informatikk, UiO To prinsipper for søking etter gener

Detaljer

I lys av akkreditering Overgang fra Sanger sekvensering til dypsekvensering innen genetisk sykdomsdiagnostikk

I lys av akkreditering Overgang fra Sanger sekvensering til dypsekvensering innen genetisk sykdomsdiagnostikk I lys av akkreditering Overgang fra Sanger sekvensering til dypsekvensering innen genetisk sykdomsdiagnostikk Knut Erik Berge, Avdeling for medisinsk genetikk, Oslo universitetssykehus Ullevål Agenda DNA

Detaljer

EKSAMENSOPPGAVE I BI3013 EKSPERIMENTELL CELLE- OG MOLEKYLÆRBIOLOGI

EKSAMENSOPPGAVE I BI3013 EKSPERIMENTELL CELLE- OG MOLEKYLÆRBIOLOGI Norges teknisk-naturvitenskapelige universitet Institutt for biologi EKSAMENSOPPGAVE I BI3013 EKSPERIMENTELL CELLE- OG MOLEKYLÆRBIOLOGI Faglig kontakt under eksamen: Jens Rohloff Tlf.: 97608994 Eksamensdato:

Detaljer

Klinisk molekylærmedisin (3): DNA-sekvensering

Klinisk molekylærmedisin (3): DNA-sekvensering Pediatrisk Endokrinologi 2002;16:51 56 Klinisk molekylærmedisin (3): DNA-sekvensering elge Ræder 1, Maria Ræder 2, Pål Rasmus Njølstad 1,3,4 1 Pediatrisk institutt, Universitetet i Bergen; 2 Anestesiavdelingen

Detaljer

Vi som står bak prosjektet er Eirik Krogstad og Petter Hannevold. Vi har gjort et prosjekt sammen med Microbial Evolution Research Group (MERG) ved

Vi som står bak prosjektet er Eirik Krogstad og Petter Hannevold. Vi har gjort et prosjekt sammen med Microbial Evolution Research Group (MERG) ved 1 Vi som står bak prosjektet er Eirik Krogstad og Petter Hannevold. Vi har gjort et prosjekt sammen med Microbial Evolution Research Group (MERG) ved Biologisk institutt, Universitetet i Oslo. Disse jobber

Detaljer

BLAST. Blast. Noen mulige sammenstilling av CHAEFAP og CAETP. Evolusjonær basis for sekvenssammenstilling. Sekvenssammenstilling og statistikken brukt

BLAST. Blast. Noen mulige sammenstilling av CHAEFAP og CAETP. Evolusjonær basis for sekvenssammenstilling. Sekvenssammenstilling og statistikken brukt Blast BLAST Sekvenssammenstilling og statistikken brukt Finner best mulig sammenstilling(er), evt. finner veldig gode sammenstillinger. Kan teoretisk unngå å finne beste sammenstilling. Avgjør om sammenstillingen

Detaljer

Flervalgsoppgaver: proteinsyntese

Flervalgsoppgaver: proteinsyntese Flervalgsoppgaver - proteinsyntese Hver oppgave har ett riktig svaralternativ. Proteinsyntese 1 Hva blir transkribert fra denne DNA sekvensen: 3'-C-C-G-A-A-T-G-T-C-5'? A) 3'-G-G-C-U-U-A-C-A-G-5' B) 3'-G-G-C-T-T-A-C-A-G-5'

Detaljer

GENER, genregulering, og genfamilier

GENER, genregulering, og genfamilier GENER, genregulering, og genfamilier 1-A, H-11 Forelesning 21.11.11 Frank Skorpen, Institutt for Laboratoriemedisin, Barne- og Kvinnesykdommer, DMF, NTNU Gener Kromosom, kromatin og DNA Hva er et gen?

Detaljer

BINGO - Kapittel 1. kroppsceller hos menn (XY) Arvelærens far (G. J. Mendel) Forkortelse for genmodifiserte organismer (GMO)

BINGO - Kapittel 1. kroppsceller hos menn (XY) Arvelærens far (G. J. Mendel) Forkortelse for genmodifiserte organismer (GMO) BINGO - Kapittel 1 Bingo-oppgaven anbefales som repetisjon etter at kapittel 1 er gjennomgått. Klipp opp tabellen (nedenfor) i 24 lapper. Gjør det klart for elevene om det er en sammenhengende rekke vannrett,

Detaljer

Molekylærbiologi: Nøkkelen til alle levende organismer

Molekylærbiologi: Nøkkelen til alle levende organismer Molekylærbiologi: Nøkkelen til alle levende organismer Svein-Ole Mikalsen Náttúruvísindadeildin Megindeildin fyri náttúru- og heilsuvísindi Fróðskaparsetur Føroya Botanikk Zoologi Genetikk Mikrobiologi

Detaljer

4.5 Lakselus vaksineutvikling

4.5 Lakselus vaksineutvikling 4.5 Lakselus vaksineutvikling Petter Frost og Frank Nilsen, Havforskningsinstituttet Ved Havforskningsinstituttet er det nylig utført forsøk som klart indikerer at det er mulig å vaksinere mot lakselus.

Detaljer

Offentlig høring av søknad EFSA/GMO/NL/2010/77 under EU-forordning 1829/2003

Offentlig høring av søknad EFSA/GMO/NL/2010/77 under EU-forordning 1829/2003 Oslo Direktoratet for naturforvaltning Tungasletta 2 Pb. 5672 Sluppen 7485 TRONDHEIM Ullevålsveien 68 Postboks 750 Sentrum 0106 Oslo Sentralbord 23 21 60 00 Faks 23 21 60 01 Saksbehandler: Arne Holst-Jensen

Detaljer

GENETISKE MEKANISMER INVOLVERT I SPREDING AV RESISTENS

GENETISKE MEKANISMER INVOLVERT I SPREDING AV RESISTENS GENETISKE MEKANISMER INVOLVERT I SPREDING AV RESISTENS KRISTIN HEGSTAD OUTLINE Hvordan erverves nye egenskaper? Mekanismer for horisontal genoverføring (HGT) Genetiske elementer involvert i spredning Definisjoner

Detaljer

Helse- og miljørisikovurdering av Monsantos genmodifiserte mais NK603 x MON 810 (EFSA/GMO/UK/2004/01)

Helse- og miljørisikovurdering av Monsantos genmodifiserte mais NK603 x MON 810 (EFSA/GMO/UK/2004/01) Uttalelse fra Faggruppe for genmodifiserte organismer i Vitenskapskomiteen for mattrygghet 27.02.08 Helse- og miljørisikovurdering av Monsantos genmodifiserte mais NK603 x MON 810 (EFSA/GMO/UK/2004/01)

Detaljer

SPISS mai 2013

SPISS mai 2013 19. mai 2013 Forskningsprosjekt Bananfluerr FORMERING AV BANANFLUER Einar AAlvik og Annelin Løvli Svendsen I dette prosjektet ville vi teste om forskjellige miljøer har noen effekt på formeringen til bananfluer?

Detaljer

Kapittel 16 Utvikling: differensielt genuttrykk

Kapittel 16 Utvikling: differensielt genuttrykk Kapittel 16 Utvikling: differensielt genuttrykk 1. Utvikling 2. Differensielt genuttrykks rolle i celledifferensiering 3. Polaritets rolle i cellebestemmelse 4. Embryonisk induksjon i cellebestemmelse

Detaljer

Miljørisikovurdering genmodifisert mais MON 89034 x NK603 fra Monsanto Company (EFSA/GMO/NL/2009/72) 1. innspillsrunde

Miljørisikovurdering genmodifisert mais MON 89034 x NK603 fra Monsanto Company (EFSA/GMO/NL/2009/72) 1. innspillsrunde Miljørisikovurdering genmodifisert mais MON 89034 x NK603 fra Monsanto Company (EFSA/GMO/NL/2009/72) 1. innspillsrunde Uttalelse fra Faggruppe for genmodifiserte organismer Vitenskapskomiteen for mattrygghet

Detaljer

Sekretær: Cand. Scient. Kirsten Rakkestad, Biologisk institutt, Universitetet i Oslo

Sekretær: Cand. Scient. Kirsten Rakkestad, Biologisk institutt, Universitetet i Oslo )RURUG Forskningsrådet nedsatte høsten 2000 en planleggingsgruppe med mandat å utrede forslag til et nytt forskningsprogram innen grunnleggende næringsrettet bioteknologi. Planleggingsgruppen har bestått

Detaljer

Status i forskning: Demens og arvelighet. Arvid Rongve Psykiatrisk Klinikk Helse Fonna

Status i forskning: Demens og arvelighet. Arvid Rongve Psykiatrisk Klinikk Helse Fonna Status i forskning: Demens og arvelighet Arvid Rongve Psykiatrisk Klinikk Helse Fonna Arvelighet og genetiske metoder Alzheimers sykdom og arvelighet Hva kan vi lære av de nye genene? Betydning for behandling

Detaljer

Offentlig høring om søknad EFSA/GMO/NL/2009/70 under EU-forordning 1829/2003 MON 87460 mais

Offentlig høring om søknad EFSA/GMO/NL/2009/70 under EU-forordning 1829/2003 MON 87460 mais Matbakteriologi og GMO Direktoratet for naturforvaltning Tungasletta 2 7485 TRONDHEIM Sentralbord: +47 23216000 Fax: +47 23216001 Saksbehandler: Arne Holst-Jensen E-post: arne.holst-jensen@vetinst.no Direktelinje:

Detaljer

Kromosomer, gener og DNA

Kromosomer, gener og DNA Kromosomer, gener og DNA Hva er det, og hvordan undersøker vi det Olaug Kristin Rødningen Dr.scient, overingeniør Avdeling for medisinsk genetikk, OUS Et menneske består av ulike organsystem Organsystemene

Detaljer

UNIVERSITETET I AGDER

UNIVERSITETET I AGDER FAKULTET FOR TEKNOLOGI OG REALFAG EKSAMEN Emnekode: BI0105 Emnenavn: Genetikk og evolusjon Dato: 21. november 2011 Varighet: 2 timer Antall sider inkl. forside 8 Tillatte hjelpemidler: Kalkulator Merknader:

Detaljer

ILA virus HPR0 i norsk oppdrettslaks fylogeografi

ILA virus HPR0 i norsk oppdrettslaks fylogeografi Programkonferansen HAVBRUK 2012, Stavanger 16-18 april 2012 ILA virus HPR0 i norsk oppdrettslaks fylogeografi Trude M Lyngstad a, Anja B Kristoffersen a, Monika J Hjortaas a, Magnus Devold b, Vidar Aspehaug

Detaljer

Epigenetikk; arvesynden i ny innpakning? Dag O. Hessen University of Oslo, Dept. Biology Center of Ecological and Evolutionary Synthesis (CEES)

Epigenetikk; arvesynden i ny innpakning? Dag O. Hessen University of Oslo, Dept. Biology Center of Ecological and Evolutionary Synthesis (CEES) Epigenetikk; arvesynden i ny innpakning? Dag O. Hessen University of Oslo, Dept. Biology Center of Ecological and Evolutionary Synthesis (CEES) Den genetiske kode Oppnøstingen av den genetiske kode foregikk

Detaljer

1. En ikke-naturlig forekommende eller konstruert sammensetning omfattende:

1. En ikke-naturlig forekommende eller konstruert sammensetning omfattende: 1 Patentkrav EP2931898 1. En ikke-naturlig forekommende eller konstruert sammensetning omfattende: et leveringssystem som er operativt konfigurert for å levere CRISPR-Caskomplekskomponenter eller polynukleotidsekvenser

Detaljer

Plan. Pensum i bioinformatikk. Hva er bioinformatikk?

Plan. Pensum i bioinformatikk. Hva er bioinformatikk? Bioinformatikk - et interessant forskningsfelt for statistikere? Mette Langaas Hva er bioinformatikk? Plan Bakgrunn i biologi (gen, genom). Forskningsområder innen bioinformatikk. Funksjonell genomikk:

Detaljer

Den genetiske revolusjon til nytte for meg?

Den genetiske revolusjon til nytte for meg? Den genetiske revolusjon til nytte for meg? Gunnar Houge Seksjonsleder/overlege Senter for medisinsk genetikk og molekylærmedisin Haukeland Universitetssykehus Hvor ofte har utviklingshemning genetisk

Detaljer

Gensøk. Oppsummering. Typer av sammenstillinger. Sammenstilling av sekvenser. To prinsipper for søking etter gener i DNA:

Gensøk. Oppsummering. Typer av sammenstillinger. Sammenstilling av sekvenser. To prinsipper for søking etter gener i DNA: Oppsummering Gensøk Oppsummeringen som gis her omfatter bare de temaer som er forelest av Ole Christian, og er ikke ment å være komplett. I korte trekk gjelder for denne delen av pensum som for de øvrige:

Detaljer

Innspill til søknad EFSA/GMO/NL/2010/89: Genmodifisert ugressmiddeltolerant mais DAS-40278-9 for import, mat og fôr under EU-forordning 1829/2003

Innspill til søknad EFSA/GMO/NL/2010/89: Genmodifisert ugressmiddeltolerant mais DAS-40278-9 for import, mat og fôr under EU-forordning 1829/2003 Direktoratet for naturforvaltning Tungasletta 2 7485 Trondheim Vår ref: Deres ref: 2011/3958 ART-BI-BRH Dato: 01.06.2011 Innspill til søknad EFSA/GMO/NL/2010/89: Genmodifisert ugressmiddeltolerant mais

Detaljer

Nytt fotopigment funnet hos fisk

Nytt fotopigment funnet hos fisk Nytt fotopigment funnet hos fisk I vår molekylære søken etter synspigmenter hos torsk ble et nytt fotopigment funnet, som tidligere ikke er kjent fra teleoster. Dette fotopigmentet hører til melanopsin

Detaljer

Nevroforskning og bevegelsesforstyrrelser i relasjon til eldre. Forskningskonferansen 19.10.12

Nevroforskning og bevegelsesforstyrrelser i relasjon til eldre. Forskningskonferansen 19.10.12 Nevroforskning og bevegelsesforstyrrelser i relasjon til eldre Forskningskonferansen 19.10.12 Nevroforskning og bevegelsesforstyrrelser i relasjon til eldre Bevegelsesforstyrrelser Parkinsons sykdom Dystoni

Detaljer

Foredlingsmetoden fra plusstreutvalg og avkomtesting til molekylær genetikk! Øystein Johnsen, Skog og landskap

Foredlingsmetoden fra plusstreutvalg og avkomtesting til molekylær genetikk! Øystein Johnsen, Skog og landskap Foredlingsmetoden fra plusstreutvalg og avkomtesting til molekylær genetikk! Øystein Johnsen, Skog og landskap St.meld. nr. 39; Klimautfordringene Regjeringen mener økt innsats i skogplanteforedlingen

Detaljer

Norges Miljøvernforbund går imot omsetning av den genmodifiserte maishybrid Bt11xMIR162xMIR604x1507x5307xGA21 under EU forordning 1829/2003.

Norges Miljøvernforbund går imot omsetning av den genmodifiserte maishybrid Bt11xMIR162xMIR604x1507x5307xGA21 under EU forordning 1829/2003. Miljødirektoratet, Pb 5672 Sluppen, N-7485 Trondheim. Svar: EFSA/GMO/DE/2011/103 Deres ref: 2014/11536 Vår ref: 2014/GMO/ZEA/Bt11xMIR162xMIR604x1507x5307xGA21 Dato: 2014-09-22 Norges Miljøvernforbund går

Detaljer

Genetikk i vår tid: Et paradigmeskifte. Kaja Selmer Avd. for medisinsk genetikk NK-SE

Genetikk i vår tid: Et paradigmeskifte. Kaja Selmer Avd. for medisinsk genetikk NK-SE Genetikk i vår tid: Et paradigmeskifte Kaja Selmer Avd. for medisinsk genetikk NK-SE Oversikt Kræsjkurs i genetikk Humangenetisk revolusjon Hvordan utreder vi barn genetisk i 2015? Et blikk mot epilepsi

Detaljer

Immunstimulanter for potensiering av torskens naturlige immunsystem

Immunstimulanter for potensiering av torskens naturlige immunsystem Store programmer HAVBRUK - En næring i vekst Faktaark www.forskningsradet.no/havbruk Immunstimulanter for potensiering av torskens naturlige immunsystem Prosjekt: Immunostimulation of Atlantic cod (Gadus

Detaljer

MOL204 Anvendt bioinformatikk I

MOL204 Anvendt bioinformatikk I Universitetet i Bergen Molekylærbiologisk institutt Matematisk-naturvitenskapelig Embetseksamen MOL204 Anvendt bioinformatikk I bokmål / nynorsk / english Fredag 17. desember 2004, 4 timer, kl 9:00-13:00

Detaljer

Grenseløs forskning. Status og behov for forskning på sjeldne tilstander

Grenseløs forskning. Status og behov for forskning på sjeldne tilstander Grenseløs forskning Status og behov for forskning på sjeldne tilstander Benedicte Paus Overlege, avdeling for medisinsk genetikk, OUS Professor i klinisk genetikk, UIO Forskning på sjeldne tilstander Forskning

Detaljer

Hvordan kan kartleggingen av laksens genom bidra til å løse utfordringene i norsk havbruksnæring

Hvordan kan kartleggingen av laksens genom bidra til å løse utfordringene i norsk havbruksnæring Hvordan kan kartleggingen av laksens genom bidra til å løse utfordringene i norsk havbruksnæring Sigbjørn Lien Centre for Integrative Genetics (CIGENE) Institutt for husdyr- og akvakulturvitenskap (IHA)

Detaljer

FAKULTET FOR TEKNOLOGI OG REALFAG EKSAMEN

FAKULTET FOR TEKNOLOGI OG REALFAG EKSAMEN g UNIVERSITETET I AGDER FAKULTET FOR TEKNOLOGI OG REALFAG EKSAMEN Emnekode: BI0105 Emnenavn: Genetikk og evolusjon Dato: 7. mai 2012 Varighet: 4 timer Antall sider inkl. forside 8 Tillatte hjelpemidler:

Detaljer

BIOINFORMATIKK ET INTERESSANT FORSKNINGSFELT FOR STATIS TIKERE? METTE LANGAAS, NORSK REGNESENTRAL Mette.Langaas@nr.no HVA ER BIOINFORMATIKK?

BIOINFORMATIKK ET INTERESSANT FORSKNINGSFELT FOR STATIS TIKERE? METTE LANGAAS, NORSK REGNESENTRAL Mette.Langaas@nr.no HVA ER BIOINFORMATIKK? BIOINFORMATIKK ET INTERESSANT FORSKNINGSFELT FOR STATIS TIKERE? METTE LANGAAS, NORSK REGNESENTRAL Mette.Langaas@nr.no HVA ER BIOINFORMATIKK? Bioinformatikk er et tverrfaglig forskningsfelt der matematikk,

Detaljer

BIOTEKNOLOGI ~ Eksempler på undervisningsaktiviteter. Fagdag ~ Gyldendal Undervisning, Mandag 31.03.2014, Ragnhild Lyngved Staberg

BIOTEKNOLOGI ~ Eksempler på undervisningsaktiviteter. Fagdag ~ Gyldendal Undervisning, Mandag 31.03.2014, Ragnhild Lyngved Staberg 1 BIOTEKNOLOGI ~ Eksempler på undervisningsaktiviteter Fagdag ~ Gyldendal Undervisning, Mandag 31.03.2014, Ragnhild Lyngved Staberg Oversikt Gi tips om praktiske aktiviteter i forhold til konkrete læreplanmål.

Detaljer

Klinisk molekylærmedisin (4): Indirekte diagnostikk ved koblingsanalyser

Klinisk molekylærmedisin (4): Indirekte diagnostikk ved koblingsanalyser PEDENDO_SISTE_slutt.qxd 18.12.2003 21:34 Side 32 Pediatrisk Endokrinologi 2003;17: 34-38 Klinisk molekylærmedisin (4): Indirekte diagnostikk ved koblingsanalyser Pål Rasmus Njølstad 1,2,3,Jørn V. Sagen

Detaljer

4. Plasmid DNA er A. sirkulært, enkelttrådet B. lineært, dobbelttrådet C. sirkulært, dobbelttrådet og supercoiled

4. Plasmid DNA er A. sirkulært, enkelttrådet B. lineært, dobbelttrådet C. sirkulært, dobbelttrådet og supercoiled Side 1 av 7 Norges teknisknaturvitenskapelige universitet Fakultet for naturvitenskap og teknologi Institutt for biologi Faglig kontaktperson(er) under eksamen: Anna Kusnierczyk EKSAMEN I: BI2015 BOKMÅL

Detaljer

Vurdering av genmodifisert insekts- og herbicidtolerant mais (C/ES/01/01) til bruk som fôrvare

Vurdering av genmodifisert insekts- og herbicidtolerant mais (C/ES/01/01) til bruk som fôrvare 10.05.04 Vurdering av genmodifisert insekts- og herbicidtolerant mais (C/ES/01/01) til bruk som fôrvare Vitenskapskomiteen for mattrygghet (VKM) viser til forespørsel fra Mattilsynet datert 28.04.2004

Detaljer

23.6.2011 EØS-tillegget til Den europeiske unions tidende RÅDSVEDTAK. av 3. oktober 2002

23.6.2011 EØS-tillegget til Den europeiske unions tidende RÅDSVEDTAK. av 3. oktober 2002 Nr. 35/727 RÅDSVEDTAK 2011/EØS/35/69 av 3. oktober 2002 om fastsettelse av en mal for sammendrag av opplysninger om markedsføring av genmodifiserte organismer som utgjør eller inngår i produkter, i henhold

Detaljer

Klipp og lim: Genredigering med CRISPR teknologi

Klipp og lim: Genredigering med CRISPR teknologi Klipp og lim: Genredigering med CRISPR teknologi Realfagskonferanse 4. mai 2017 Magnar Bjørås Institutt for kreftforskning og molekylærmedisin, NTNU Klinikk for laboratoriemedisin, Oslo Universitetssykehus

Detaljer

EKSAMENSOPPGAVE I BI2015 Molekylærbiologi laboratoriekurs

EKSAMENSOPPGAVE I BI2015 Molekylærbiologi laboratoriekurs Norges teknisk-naturvitenskapelige universitet Institutt for biologi EKSAMENSOPPGAVE I BI2015 Molekylærbiologi laboratoriekurs Faglig kontakt under eksamen: Anders Øverby og Bjørnar Sporsheim Tlf.: 99778490

Detaljer

Svar til oppgaver i Hartwell

Svar til oppgaver i Hartwell Svar til oppgaver i Hartwell Kap.2 2.12: Hva er sjansen for at avkommet har den samme fenotype som en av de to foreldrene? a) AaBbCcDd x aabbccdd =P(A-B-C-D-) eller P(aabbccdd) = 1/2*1/2*1/2*1/2 + 1/2*1/2*1/2*1/2=2/16

Detaljer

Mal for vurderingsbidrag

Mal for vurderingsbidrag Mal for vurderingsbidrag Fag: Naturfag Tema: Tar for seg følgende i lærerplanen. Beskrive oppbygningen av dyreceller. Gjøre greie for celledeling samt genetisk variasjon og arv. Temaet brukes ofte som

Detaljer

FLERVALGSOPPGAVER ARV

FLERVALGSOPPGAVER ARV FLERVALGSOPPGAVER ARV Hvert spørsmål har ett riktig svaralternativ. Arv 1 En organisme med to identiske alleler for en egenskap blir kalt A) homozygot B) dominant C) selvpollinerende D) heterozygot Arv

Detaljer

Examination paper for Bi2014 Molecular Biology

Examination paper for Bi2014 Molecular Biology Department of Biology Examination paper for Bi2014 Molecular Biology Academic contact during examination: Professor Atle M. Bones Phone: 91897237 (73598692) Examination date/eksamensdag: 7. December 2016

Detaljer

Vegard Eldholm. Molekylær TB epidemiologi

Vegard Eldholm. Molekylær TB epidemiologi Vegard Eldholm Molekylær TB epidemiologi Molekylærepidemiologiske metoder Sannsynliggjøre eller avkrefte transmisjonslinker mellom TB pasienter. Avdekke krysskontaminasjon i laboratoriet Skille reinfeksjon

Detaljer

UNIVERSITETET I OSLO

UNIVERSITETET I OSLO UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet Eksamen i: MBV3070 Eksamensdag: 10. juni 2005 Tid for eksamen: 9:00 12:00 Oppgavesettet er på 3 side(r) Vedlegg: Ingen Tillatte hjelpemidler:

Detaljer

Født sånn eller blitt sånn: om gener, søppel-dna og epigenetikk

Født sånn eller blitt sånn: om gener, søppel-dna og epigenetikk Født sånn eller blitt sånn: om gener, søppel-dna og epigenetikk Dag O. Hessen University of Oslo, Dept. Biology Center of Ecological and Evolutionary Synthesis (CEES) Kappløpet et (kort) historisk tilbakeblikk

Detaljer

1. INNLEDENDE GENETIKK 2 2. DNA - RNA 4 5. TRANSLASJON 6 6. REGULERING AV GENER 6 7. EUKARYOTE GENER 8 8. DNA REPLIKASJON, 8

1. INNLEDENDE GENETIKK 2 2. DNA - RNA 4 5. TRANSLASJON 6 6. REGULERING AV GENER 6 7. EUKARYOTE GENER 8 8. DNA REPLIKASJON, 8 OPPGAVER I GENETIKK Innholdsfortegnelse 1. INNLEDENDE GENETIKK 2 2. DNA - RNA 4 3.TRANSKRIPSJON 5 5. TRANSLASJON 6 6. REGULERING AV GENER 6 7. EUKARYOTE GENER 8 8. DNA REPLIKASJON, 8 9. MUTASJONER, REPARASJON

Detaljer

KONTROLL AV PLANTEMORFOLOGI VED HJELP AV TEMPERATUR OG UV-LYS

KONTROLL AV PLANTEMORFOLOGI VED HJELP AV TEMPERATUR OG UV-LYS KONTROLL AV PLANTEMORFOLOGI VED HJELP AV TEMPERATUR OG UV-LYS Jorunn E. Olsen Institutt for plante og miljøvitenskap, Universitetet for miljø- og biovitenskap Micael Wendell, Amsalu G Roro, Deepak Mahat,

Detaljer

Kontinuasjonseksamen, MEDSEM2/ODSEM2/ERNSEM2 høst 2007 Onsdag 20. februar 2008 kl. 09:00-15:00

Kontinuasjonseksamen, MEDSEM2/ODSEM2/ERNSEM2 høst 2007 Onsdag 20. februar 2008 kl. 09:00-15:00 Kontinuasjonseksamen, MEDSEM2/ODSEM2/ERNSEM2 høst 2007 Onsdag 20. februar 2008 kl. 09:00-15:00 A. (18) Psoriasis er en sykdom som viser multifaktoriell arv. 1. Forklar hva som menes med begrepet multifaktoriell

Detaljer

Miljørisikovurdering genmodifisert mais MON 89034 x MON 88017 fra Monsanto Company (EFSA/GMO/BE/2009/71) 1. innspillsrunde

Miljørisikovurdering genmodifisert mais MON 89034 x MON 88017 fra Monsanto Company (EFSA/GMO/BE/2009/71) 1. innspillsrunde Miljørisikovurdering genmodifisert mais MON 89034 x MON 88017 fra Monsanto Company (EFSA/GMO/BE/2009/71) 1. innspillsrunde Uttalelse fra Faggruppe for genmodifiserte organismer Vitenskapskomiteen for mattrygghet

Detaljer

GENTEKNOLOGISK ARBEID MED NAKENT DNA

GENTEKNOLOGISK ARBEID MED NAKENT DNA Sosial- og helsedepartementet Pb 8011 Dep. 0030 OSLO Oslo, 2. mai 1996. Ref. 96/00015-003RKA/401 GENTEKNOLOGISK ARBEID MED NAKENT DNA Det vises til brev fra Sosial- og helsedepartementet datert 6. februar

Detaljer

Født sånn OG blitt sånn: gener og miljø i barns utvikling

Født sånn OG blitt sånn: gener og miljø i barns utvikling Født sånn OG blitt sånn: gener og miljø i barns utvikling TTiT Tidlig Trygg i Trondheim Barn født i 2003/2004 Foreldre, lærere 1000 barn Identifiserer risiko og beskyttelsesfaktorer for utvikling av psykisk

Detaljer

Obligatorisk innlevering 3kb vår 2004

Obligatorisk innlevering 3kb vår 2004 Obligatorisk innlevering 3kb vår 2004 1 I marsvin er mørk pels farge (F) dominant over albino (f), og hår (K) dominant over langt hår (k). Genene for disse to egenskapene følger prinsippet om uavhengig

Detaljer

TBT4170 Bioteknologi Eksamensnotater. Audun F. Buene audunfor@stud.ntnu.no

TBT4170 Bioteknologi Eksamensnotater. Audun F. Buene audunfor@stud.ntnu.no TBT4170 Bioteknologi Eksamensnotater Audun F. Buene audunfor@stud.ntnu.no 9. mai 2012 Chapter 1: Basics of biotechology DNA står for deoxyribonucleic acid og er bygget opp av lange kjeder med nukleotider.

Detaljer

Spørsmål i tilknytning til bruk av CRISPR. Notat oktober 2016 Sidsel Børresen, biolog cand.real UiO

Spørsmål i tilknytning til bruk av CRISPR. Notat oktober 2016 Sidsel Børresen, biolog cand.real UiO Spørsmål i tilknytning til bruk av CRISPR. Notat oktober 2016 Sidsel Børresen, biolog cand.real UiO CRISPR er en ny genteknologisk metode, kalt genredigering. Den ble lansert for bare 3-4 år siden. Metoden

Detaljer

KYSTTORSK OG SKREI I LOFOTEN 2009

KYSTTORSK OG SKREI I LOFOTEN 2009 KYSTTORSK OG SKREI I LOFOTEN 2009 Resultater fra DNA-typing av torsk ved bruk av PCR metode Websaknr. 09/12473 Fiskeridirektoratet region Nordland Fiskerikontoret i Svolvær Mai 2009 Erun Thesen Bioingeniør/Inspektør

Detaljer