Veileder for kravspesifisering. for digitale læringsplattformer og digitale læringsressurser

Størrelse: px
Begynne med side:

Download "Veileder for kravspesifisering. for digitale læringsplattformer og digitale læringsressurser"

Transkript

1 Veileder for kravspesifisering for digitale læringsplattformer og digitale læringsressurser

2 Kravspesifisering s.2av54 Innholdsfortegnelse KRAVSPESIFISERING...3 BEOVSANALYSE...8 OMFANGSBESKRIVELSE...12 TEKNISKPLATTFORM...14 INTERESSENTANALYSE...15 KONTEKSTDIAGRAM...18 KRAVANALYSE...20 KRAVMODELL...22 BRUKERISTORIER...23 BRUKSTILFELLER...29 KONSEPTPOGDATAMODELLER...36 KRAVUTFORMING...43 KRAVPLØSNING...46 KRAVPGJENNOMFØRING...50 ORDLISTE...53

3 Kravspesifisering Prosess KRAVSPESIFISERING Dereskalanskaffeendigitallæringsplattform(LMS Learning ManagementSystem)ellerendigitallæringsressurs.Idenforbindelse mådufåpåplassenkravspesifikasjon.engodkravspesifikasjoner nødvendigforåsikreatmanfårdetmanharbehovforogforåhindre atmanfårubehageligoverraskelsersomsprekkpåtidogbudsjetti prosjektet.detåutformekraveretegetfag.nårdetteikkeernoeman gjørtildagligogmanharbegrensetmedtidpåseg,kandetværegodt medhjelp.detgirdenneverktøykassen. Verktøykassenbestårav: En prosess for å utarbeide kravspesifikasjonen med hvert trinn beskrevet som egne aktiviteter. For hver aktivitet skal det utarbeides leveranser som enten er en del av sluttproduktet, kravspesifikasjonen, eller er dokumenter som skal brukes i senere aktiviteter. For hver leveranse inneholder verktøykassen maler og eksempler. En aktivitet kan utføres på ulike måter og verktøykassen beskriver noen av disse måtene som verktøy. Til verktøyene er det også ofte maler og eksempler. s.3av54 Input Output Omfangsbeskrivelse s.12 Teknisk plattform s.14 Kravmodell s. 22 Krav - løsning s. 46 Krav - gjennomføring s. 50 Aktiviteter Behovsanalyse s. 8 Kravanalyse s. 20 Kravutforming s. 43

4 Kravspesifisering s.4av54 Aktivitet Behovsanalyse Kravanalyse Kravutforming Leveranser Omfangsbeskrivelse Kravmodell Omfangsbeskrivelse Eksempel Kravmodell Eksempel DLR.docx DLR.docx Omfangsbeskrivelse Eksempel Kravmodell Eksempel LMS.docx LMS.docx Omfangsbeskrivelse Mal DLR.dotx Omfangsrbeskrivelse Mal LMS.dotx Tekniskplattform Teknisk plattform Eksempel.docx Teknisk plattform Mal.dotx Verktøy Delavhelhet Interessentanalyse Interessentanalyse Eksempel DLR.docx Interessentanalyse Eksempel LMS.docx Interessentanalyse Mal DLR.dotx Interessentanalyse Mal LMS.dotx Kontekstdiagram Kontekstdiagram Eksempel DLR.docx Kontekstdiagram Eksempel LMS.docx Kontekstdiagram Mal DLR.dotx Kontekstdiagram Mal LMS.dotx Detåspesifiserekraverendelavenstørrehelhet. Endringsprogram Brukstilfeller Brukerhistorier Konsept1og datamodeller Krav Løsning Krav Gjennomføring Krav Eksempel DLR.docx IT1implementeringsprosjekt Anskaffelse KravspesiUisering Figur1Kravspesifiseringsomdelavenhelhet Figurenovenforviserhvordandetåspesifiserekraverendelaven størrehelhet.umiddelbarterdetåspesifiserekraveneendelav anskaffelsesprosessen.kravspesifikasjonenvilinngåsomendelav

5 Kravspesifisering s.5av54 konkurransegrunnlagetogerdetviktigstekommunikasjonsmiddelet manhartilpotensielleleverandører.kravspesifikasjonenerogså essensiellivurderingavtilbudeneogvilinngåiendelavavtalenmed leverandøren. Mendetstopperikkeder.Kravspesifikasjonenbørværeetlevende dokument,etdokumentsombrukesunderhele implementeringsprosjektet.denkanbrukestilåadministrere anskaffelsen,tilåfølgemedpåatmanblirlevertdetmanblelovetog tilåhåndtereendringer.kravspesifikasjonenerogsågrunnlagetfor godkjenningavleveranser.godkjenningstesterverifisererat løsningentilfredsstillerkravene. Etinformasjonssystemharingenverdiisegselv.Verdienliggeriat detgjørdetmuligåarbeidebedre.sålengedetikkeersnakkomet rentit1drevetsystemskifte,børderforetit1implementeringsprosjekt inngåsomendelietstørreendringsprogramdermanogsåserpå organisasjonsutviklingforåoppnågevinstenemanønskerseg. Envelprøvdprosess Kravspesifiseringeretprosjektisegselv.Deterflereaktivitetersom måutføresogdeharennaturligrekkefølge.figurennedenforviserde trestegeneiprosessen. Figur2Prosessforkravspesifisering Ihvertavdissestegeneerdetflereuliketingsomgjøres,mende gjøresgjerneiparallell. Værmålrettet,startmedbehovene Førstestegerbehovsanalysen.Førmangraversegnedidetaljenefor hvordanlæringsplattformenellerlæringsressursenskalvære,bør manløfteblikketogstartemedbehoveneforløsningen,hvilken kontekstdenskalinngåiogpåeventueltandreføringersomgjelder forløsningen. Behoveneerkanskjeallerededefinertietendringsprogram,hvisikke, kanmanutføreenenkelinteressentanalyse.vempåvirkesav innføringenavløsningen?vilkemål,forhåpningerogbekymringer hardisse?interessentererikkebarebrukerneavsystemet,som eleveroglærere,menogsåandresomskoleledereog1eieresomhar eninteresseavhvordanundervisningenfungerer.deterher nødvendigåværesværtpragmatisk.determyemankunneønskeseg, Behovsanalyse Kravanalyse Kravutforming

6 Kravspesifisering s.6av54 mensomlikevelikkeerverdtdenødvendigeinvesteringene.alle interessentenesbehovmåkommefremiinteressentanalysenogder manvelgeråikketahøydefornoenavdisse,skaldetteeksplisitt kommefremiomfangsbeskrivelsentilprosjektet.dettehindrer senereskuffelserogdiskusjoneromhvasomskalværemedi prosjektetellerikke. Løsningenskalpasseinnienkontekst.Deflesteskolerharflere systemerogdetnyemåpasseinnidenporteføljenmanharoghelst væreintegrertslikatmanslipperdobbeltregistreringerog inkonsistenser.etkontekstdiagramviserhvordanløsningenpasser innsammenmedomliggendesystemer. Deterføringerforhvordanløsningenkanvære.Noenavdisseer lovpålagtegjennomforeksempelopplæringslovenogspråkloven, andreeroffentligeogbransjestandarderdeterhensiktsmessigå forholdesegtil,ellerinterneretningslinjerforeksempelforvalgav tekniskplattform. Komplett,konsistent,klarogkorrekt Andrestegerkravanalysen.Vigårnåethakklengerned,frahvordan systemetskalpasseinnivirksomhetentilhvordandetskalfungere. Vianbefaleråbrukemodellersombelysersystemetfraulikevinkler. Detteeretviktigkvalitetssikringstiltak.Modellererenklereåsjekke forkompletthet,konsistensogkorrekthetennfriformprosaellerlange listermedkrav.degjørdetogsåenklereforossselvogenleverandør åfåoversiktogforståinnholdet. Ikravanalysenservipåfølgende: Begreper Brukere Regler endelser vordan systemet skal fungere va systemet skal kunne gi oss innsikt i (rapporteringsbehov) ViserbådepåmodelleringvedhjelpavstandardenUMLogpånoen andreteknikkersomerpopulæreblantdemsombrukersmidige prosjektmetoder. Grunnlagforvurdering Sistestegerkravutformingen.Detgårutpååtadeninnsiktenvinå harfåttogspesifiseredisseietmålbartformatslikatmankan vurderetilbudeneogsenereåverifisereatmanharfåttdetmanbad om.dettegjelderbådekravtilfunksjonalitet,ikke1funksjonellekrav ogkravtilprosjektgjennomføringen. Kravenemåutformesslikatdetkommertydeligfremhvasomer styrkeneogsvakheteneveddetilbudteløsningene,samtidigsomde

7 Kravspesifisering s.7av54 tillateratviutviserskjønnogatdeikkeunødvendigdiskvalifiserer godetilbud. Ikkepåbarbakke Verktøykassenerikkebareenbeskrivelseavenprosess,menogsået settmedheltellerdelvisutfyltemalersomgiretgodtutgangspunkt forkravspesifiseringavenlæringsplattform.maleneerblantannet basertpåettitallskravspesifikasjonerforlæringsplattformerfra kommunerogfylkerinorge,samtnoefraandreland. Dissemaleneerbareetutgangspunkt.Deterviktigatderestrykerog tilførermedhardhånd.ikkebeomnoedereikkehartenkttilåbruke, detførerbaretilatløsningeneblirunødvendigdyre.

8 Kravspesifisering s.8av54 Aktivitet BEOVSANALYSE Dereskalanskaffeendigitallæringsplattform(LMS Learning ManagementSystem)ellerendigitallæringsressurs.Idenforbindelse mådufåpåplassenkravspesifikasjon.engodkravspesifikasjon sikreratmanfårvalutaforpengene. Idetmansetterigangarbeidetmedåspesifiserekrav,vetmanikke alltidhvamanønskeråoppnå.ikkealleit1anskaffelserharsin opprinnelseietendringsprogrammedtydeligegevinstmåloget veldefinertmandat.kanskjeerdetikkepedagogiskehensynsomhar utløstbehovet,mensnarereit1ogavtalemessigehensyn.dettekan væreateksisterendesystembyggerpåutdatertteknologi,etønske omkostnadsreduksjongjennomkonsolideringavsystemerellerat avtalerforeksisterendesystemerløperut. Forålykkesmedetprosjekt,mådethaklaremål.Manmåvitehva suksesserforåkunneoppnådet.klaremålforprosjektetvilhjelpei arbeidetmedkravene.degjøratmankansikreatdeertilstrekkelige foråoppnåmålene.degjørogsåatmanunngårunødvendige kostnadervedådroppeunødvendigekrav. Formåletvedprosjekteterogsåviktigeianskaffelsenogiavtalen.De hjelperitolkningenavkravene.deterderfordegjernetasmedførsti bilag1 kundenskravspesifikasjonistatensstandardavtaler(ssa) 1. Skullemanværesåuheldigatmankommeroppienkonfliktmed leverandøren,såfinnesdetrettspraksispåatkundensformålved anskaffelsenskaltilleggesvekt. Itilleggtilformålet,erdetogsåannenbakgrunnsinformasjonsom manmåhamed.detteerblantannettekniskplattform(somskalmed ibilag3 kundenstekniskeplattformhvismanbrukerstatens standardavtaler),andresystemerogintegrasjoneroghvasom eventueltskalerstattesiprosjektet. Behovsanalysenkangjøresitrestegsomskissertifigurennedenfor. Prosess Kravspesifisering s. 3 Input Output Omfangsbeskrivelse s. 12 Teknisk plattform s. 14 Verktøy Interessentanalyse s. 15 Kontekstdiagram s. 18 Kartlegge ønsker DeUinér målene Dokumenter kontekst Figur3Stegeneienbehovsanalyse 1

9 Kravspesifisering s.9av54 Kartleggeønsker Førstestegeråfinneuthvilkebehovsomfinnes.Engreimåteågjøre dettepåeråforetaeninteressentanalyse.finnuthvemsomblir berørtavprosjektet,interessentene,ogkartlegghvilkeinteresser dissefaktiskhar.interessentenekanbådeværebrukereogandre, bådeinterneogeksterne.ønskenedukartleggerhereroverordnede forretningsmessigeønsker,ikkedetaljertekravtilløsningen. Definérmålene Etteratmanharidentifisertinteressenteneogkartlagtderes interesser,kanmangåvidereogdefineremåleneogføringene. Måleneerdetviønskeråoppnå,mensføringererbegrensningeri hvordanvikanoppnådissemålene. Dukanikketilfredsstilleallefullstendig.Noeerrettogslettikkemulig åfåtil,annetkostermerenndetsmaker.eteksempelpådetsistekan væreetønskehosenbrukeromenegenskapsomvilspare vedkommendeformyearbeid,mensomvilkostemeråutvikleog vedlikeholdeenndetmanvilsparevedåfrigjøredenansattetilandre oppgaver.iandretilfellerharmanmotstridendeinteresseråhanskes med.dettegjelderbådemellominteressenterogogsåhosdeneneog sammeinteressenten.detsistekanforeksempelskjevedatenbruker ønskersegstatistikkerogoversikter,mensamtidigikkeønskerå bruketidpåregistrereunderlagsmaterialet. Dumåprioritere.Iogmedatdetikkeermuligåtilfredsstillealle ønskenetilinteressentenemåduprioriteremellomdem.noenganger harmanikkenoevalg;noeerlovpålagt.eksemplerpådettekanvære atmanikkeharanledningtilåeksporterepersonopplysningertilhvor somhelstiverdenogatløsningenmåværeuniverseltutformethvis manåpnerforbrukereutenforskolensomelevenesforesatte.slike føringerkanogsåværeinterne,foreksempelenstandardiseringpåen bestemttypedatabasestyringssystem. Derduharetvalg,børduværepragmatisk.Dumåveiedeulike måleneutifra: nytte (helst målbar) kost risiko tid det man kan få til tidlig er å foretrekke fremfor det som tar lang tid å få på plass grad av nyvinning dette henger sammen med risiko, tenker man nytt er det større risiko for at noe ikke vil virke slik man ser det for seg eller at det vil koste mer enn man tror. Målenemåforankresogdakandethendeatdumågidegogginoe høyereprioritetennvurderingenovertilsier.noeninteressenterhar

10 Kravspesifisering s.10av54 såmyemaktoginnflytelseatprosjektetikkevillaseggjøreutenatde fårmedsineønsker. Værtydelig.Nårmanslitermedåforankretmåleneogåoppnå konsensus,kandetværefristendeåtytilknepfradiplomatietogla tingværevageslikatalleredderansiktogkansiatdeharvunnet frem.ikkegjørdet.systemerblirkonkreteførellersenereogaltman oppnåreråutsettekonflikten. Detåværetydeligbeståriåeksplisittsihvasomermed,oghvasom ikkeerdet.detteerenviktigdelavforventningsstyring.tydelighet betyrogsåatmåleneermålbare,atmankategoriskkanfastslåom manharnådddemellerikke.målomhvasystemetskaltilbybrukerne avfunksjonalitetkanforeksempeldokumenteresiethøynivå brukstilfellediagram. Dokumenterkontekst Deterikkebaremålogføringersomernyttigbakgrunnsinformasjon tilkravene.itilleggkommerblantannetbeskrivelseavnå1 situasjonen,tekniskplattformoghvilkeandresystemerløsningenmå forholdesegtil. Nåsituasjonen,foreksempelhvilkesystemermanskalerstatte,eren faktormantahøydefor.vabrukerneervanttilidagharbetydning forhvaslagsopplæringsomeventueltblirnødvendigmedinnføring avleverandørensløsning.dagenssystemsierogsånoeomhvordanen eventuellkonverteringavdatamågjøres. Leverandørenharogsåbehovforåvitenoeomkundenstekniske plattform.istatensstandardavtalerorienteresdetomdetteibilag3.i tilleggvilmansomregelstillekravtilatløsningenfungereridenne plattformen,noesomgjøresibilag1. Medtekniskplattformmenesutstyrogprogramvarebådepåklient1 ogtjenersiden.påklientsidenvildettetypiskværehvaslags personligedatamaskiner,smarttelefoner,nettbrettogskrivereman har.relevantinformasjonvilværeskjermstørrelse,hvorraske prosessoreneer,hvormyeprimærminneoglagringsplassdeer utstyrtmedogoperativsystem.itilleggkommerprogramvaredeer utstyrtmedsomnettleserogkontorprogrammer(epost, tekstbehandling,regnearkogpresentasjon). Påtjenersidenharmaninfrastruktur(maskinvare,nettverk, operativsystem,sentralisertedatahallerellerdistribuertetjenere)og plattform(databasestyringssystem,applikasjonstjenereogannen mellomvare). ModerneIT1systemerforventesåfungeresammenmedandre systemer.demåintegreresogintegrasjonerkrevendeogfordyrende. Detteskyldesatmangedetgjerneermangeparterinvolvertogat

11 Kravspesifisering s.11av54 arbeidmåkoordinerespåtvers.etkontekstdiagramerengodmåteå gienoversiktoverdenødvendigeintegrasjonene.etkontekstdiagram erethøynivådataflytdiagramsomviserdataflytmellometsystemog omverdenen.

12 Kravspesifisering Leveranse OMFANGSBESKRIVELSE Omfangsbeskrivelsenerdenviktigsteleveransenfrabehovsanalysen. Dengirenoversiktoverproduktetsomskalleverespåetoverordnet, forretningsmessignivå.omfangsbeskrivelsendannergrunnlagfor kravanalysen,ogtasgjernemedførstibilag1 kundens kravspesifikasjonistatensstandardavtaler(ssa) 2. Omfangsbeskrivelsenbeståravfølgende: Formål Leveranser Føringer Forutsetninger Formåleterdetviønskeråoppnåmedprosjektet,grunnentilatdet harblittsattigang.godemålerkonkreteogdetermuligåobjektiv slåfastommanharnådddemellerikke. Leveransererhvavimenerprosjektetmålevereforatviskalkunne oppnåmålene.likeviktigerdetåværeklarpåhvasomikkeskal leveres.deterviktigbådeforåholdekostnadenenedeogistyringav forventninger.godemåteråuttrykkehvasomermedogikkeer brukstilfellediagrammedoverordnedebrukstilfellerfor sluttbrukerrettetfunksjonalitetogkontekstdiagramforintegrasjonav systemer. Føringererbegrensningerihvordanprosjektetkanutforme løsningen.dettekankommefralovpålagtekrav,standarderman ønskeråforholdesegtilellerstrategiskevalgmanhargjorti organisasjonen,foreksempelatmanønskeråstandardiserepåen bestemttekniskplattform. Iplanleggingmåmangjøreenrekkeforutsetninger,beslutningerom hvamantrorertilfellet.deterikkealltidmulig,elleriallefallfordyrt åtidkrevendetilåslåfastomnoefaktiskertilfellet.detkanvære betydeligrisikoknyttettilhvorvidtforutsetningeneholderellerikke, ogdeterderforåviktigatdissekommerklartfrem.iprosjektplanen børmanhaenoversiktoverrisikoogstrategiforhåndteringavde ulikerisikoene. s.12av54 Inputtil Kravanalyse s. 20 Outputfra Behovsanalyse s. 8 Filer Fil Omfangsbeskrivelse EksempelLMS.docx Type Eksempel 2

13 Kravspesifisering s.13av54 Omfangsbeskrivelse EksempelDLR.docx Omfangsbeskrivelse MalLMS.docx Omfangsbeskrivelse MalDLR.docx Eksempel Mal Mal Omfangsbeskrivelse - Eksempel LMS.docx Omfangsbeskrivelse - Eksempel DLR.docx Omfangsbeskrivelse - Mal LMS.dotx Omfangsbeskrivelse - Mal DLR.dotx

14 Kravspesifisering Leveranse TEKNISK'PLATTFORM Dentekniskeplattformenerviktigbakgrunnsinformasjon.Den dannergrunnlagforendelikke1funksjonellekravogtasmedtil orienteringtilleverandørenibilag3 kundenstekniskeplattformi Statensstandardavtaler(SSA) 3. Dentekniskeplattformenbeskriverhvilketutstyrmanhar,bådepå tjenersidenogpåklientsiden,bådemaskinvareogprogramvare,både organisasjonensegetutstyrogeventueltegetutstyrbrukernekan kommetilåbruke. Påtjenersidenbørmanbeskriveinfrastrukturogplattform. Infrastrukturvilsi: tjenere for lagring, applikasjoner og database hvordan de er lokalisert i for eksempel datasentre nettverk, internt og eksternt operativsystem Plattformerdatabaseogmellomvaremanbenyttersomblantannet: databasestyringssystem applikasjonstjenere brukeradministrativt system Påklientsidenbeskrivermanpersonligedatamaskineroghåndholdte enhetermedoperativsystem,nettlesereogprogramvarefor kontorstøtte.visbrukerneharanledningtilåbrukeegneenheter, børmanogsåbeskrivehvamankanforventeatdeharavutstyr. s.14av54 Inputtil Kravanalyse s. 20 Outputfra Behovsanalyse s. 8 Filer Fil Tekniskplattform Eksempel.docx Tekniskplattform Mal.dotx Type Eksempel Mal Teknisk plattform - Eksempel.docx Teknisk plattform - Mal.dotx 3

15 Kravspesifisering s.15av54 Verktøy INTERESSENTANALYSE Duerheltistartenmedarbeidetmedenkravspesifikasjonogskal finneuthvilkebehovsomfinnes.engreimåteågjøredettepåerå foretaeninteressentanalyse.finnuthvemsomblirberørtav prosjektet,interessentene,ogkartlegghvilkeinteresserdissefaktisk har. Identifisérinteressentene Viønskeråoppnåverdioghvisnoeerverdifullt,såerdetverdifullt fornoen.interessentererdefinertsomdemsompåetellerannetvis blirberørtavprosjektet.detkanværedesomblirberørtavmålet, produktetellertjenestenprosjektetskalprodusere.detkanogså væredesomblirpåvirketavreisen,selveutførelsenavprosjektet.et eksempelpådetsisteerdesommåavståmedressursertilprosjektet. Dufinnerfremtilinteressentenevedålesedegoppogsnakkemed folk.typiskekildererprosjektmandatet,styrendedokumenterfor skolenogskoleeier,loverogregler,standarderogdokumentasjonfra tidligereprosjekter.restenkandufinnevedåsnakkemedfagfolkog deinteressenteneduharfunnetsålangt. Brukerneeropplagteinteressenter.Mendeterikkebaresluttbrukere somerbrukere.sluttbrukereerdesomskalbrukeløsningenisitt arbeid.forenlæringsplattformvildettetypiskværefaglærere,elever, fagledere,kontaktlærereogforesatte.støttebrukerederimoterde somhardetsomsittarbeidatløsningenkanbrukes.detteer systemadministratorerogpersonellsomdrivermeddriftog forvaltningavsystemet.voreffektivtsystemeteråarbeidemedfor disseharmyeåsifordrifts1ogvedlikeholdskostnadene. Itilleggtilbrukereerdetogsåandresomerlegitimeinteressenter. Detkanværebrukereavandresystemersomerintegrertmed læringsplattformen.itilleggerdetofteslikatvirksomhetssystemer snarereharverdifordemsomønskerarbeidetutførtennfordem somskalutføredet.interessentenekanværeinterne.detkanfor eksempelværeskoleledelsen,administrativtpersonellogit1 avdelingen.interessentenekanværeeksterne.dettekanforeksempel væreskoleeiere,myndighetermedansvarforskole,ellerandre myndighetermedansvarforannetsliksompersonvernogbrukav informasjonsteknologiioffentligsektor,innholdsleverandørerog borgerneiområdetellerilandetsomhelhet. Kartlegginteressene Nårduskalkartleggeinteressene,erdetenrekkespørsmåldutrenger svarpåforhveravdem: Brukti Behovsanalyse s. 8

16 Kravspesifisering s.16av54 vem er du? Dette er en beskrivelse av interessentene. va slags stilling de har og hva de har ansvar for. vordan berøres du? Dette er hvordan interessentene vil bli berørt av prosjektet. Kommer de til å bruke sluttproduktet? Vil de bli involvert i arbeidet med å få det frem? Vil det koste dem noe? vor interessert er du? Dette angir hvor interessert de er i prosjektet, noe prosjektledelsen vil bruke i planleggingen av kommunikasjonen i prosjektet. va ønsker du? Dette er målene interessentene ønsker seg ut fra prosjektet. va forventer du? Ofte er det slik at forventninger og ønsker ikke er de samme. Man tror gjerne ikke at man kommer til å få alt man ønsker seg. va bekymrer deg? Dette er uheldige konsekvenser man er redd for at prosjektet vil medføre. Deterforskjelligemåteråkommefremtilsvarenepådisse spørsmåleneogmanmågjernebrukeforskjelligeteknikkerfor forskjelligeinteressenter: Forskning. Det finnes mye forskning på hvordan man arbeider i skolen og hvordan man lærer. Det finnes for eksempler flere studier på hva lærere bruker tid på og hva som blir betraktet som administrative byrder. Lover, regler, standarder. Dette er spesielt relevant når interessentene er myndighetene og bransjeaktører. Disse er det ikke alltid så lett å intervjue, men hva de ønsker er gjerne dokumentert i lover, regler og standarder. Spørreundersøkelser. Dette er en grei måte å nå mange på, men den har sine begrensninger i hvor dypt man kan gå og i at man må tenke seg frem til alle spørsmålene før man gjør undersøkelsen. Intervjuer og fokusgrupper. Dette er en grei måte å gå mer i dybden, men det er begrenset hvor mange man kan snakke med. Observasjoner. Dette er en god måte å undersøke hvordan man arbeider i dag. Med perspektiv fra en utenfra kan man se muligheter for forbedringer brukerne ikke er klar over selv. Målinger. Ingen ting er bedre enn konkrete tall når man ønsker å gi konkrete mål for forbedringer. Målingene kan gjøres ved hjelp av observasjoner i felt eller i laboratorium, gjennom egenrapportering i spørreundersøkelser eller ved hjelp av instrumentering av eksisterende systemer som for eksempel logging av feilsituasjoner, hvor lang tid tar osv. Forbrukerneerdetikkenødvendigågåveldiglangtidybdenidenne fasen,barenoktilåfåpåplassdeviktigstemålene.mankommertilå gåmyemeridetaljikravanalysen. Filer

17 Kravspesifisering s.17av54 Fil Interessentanalyse EksempelLMS.docx Interessentanalyse EksempelDLR.docx Interessentanalyse MalLMS.doct Interessentanalyse MalDLR.doct Type Eksempel Eksempel Mal Mal Interessentanalyse - Eksempel LMS.docx Interessentanalyse - Eksempel DLR.docx Interessentanalyse - Mal DLR.dotx Interessentanalyse - Mal DLR.dotx

18 Kravspesifisering s.18av54 Verktøy KONTEKSTDIAGRAM ModerneIT1systemerforventesåfungeresammenmedandre systemer;demåintegreres.deterviktigåfåengodoversiktover dettearbeidettidlig.arbeidmedintegrasjonerisinnaturkomplekst. Detgårpåtversavsystemerogdetergjerneflereulikeparter involvertidet.integrasjonenegårpåtversavsystemer,noesombetyr atmangjerneharbehovforulikkompetanse.itilleggkandetvære vanskeligåfåtilentestpåtversavsystemeneunderutvikling,noe somkangiubehageligeoverraskelsersenere.normaltkanmanheller ikkeforventeatdeeksisterendesystemeneforvaltesavdesomtilbyr detnyesystemet,ogmanvilmåtteinvolvereflereparteriarbeidet medintegrasjonene.detteøkerbehovetforkoordinering. Etkontekstdiagramgirengodoversiktoverdenødvendige integrasjonene.detviserdataflytmellometsystemogomverdenen. Determedandreordetsværthøynivådataflytdiagramsomikkeviser interndataflytisystemet.kontekstdiagrammeteretgodtsupplement tilbrukstilfellediagram.detsistefokusererpåsluttbrukeresbrukav systemet,mensdetførstefokusererpåsamhandlingmellom systemenesomikkeisegselvharverdiforbrukerne. Ikontekstdiagrammetervårtsystemavbildetsomenovalellersirkel imidtenavdiagrammet.systemenedetskalintegreresmedtegnes somomkringliggenderektangler.selvedataflyteneertegnetsom piler.tegnbarelogiskdataflyt,ikkedataflytkunknyttettil protokollenesystemenebrukeriintegrasjonen. Figur4Eksempelpåkontekstdiagram. Figur4ovenforvisereteksempelpåetkontekstdiagram.ereren læringsplattformintegrertmedfeide,brukeradministrativtsystemog skoleadministrativtsystem.læringsplattformenfårinformasjonom enbrukersidentitetfrafeide,oghvilkenrollebrukerenharfra brukeradministrativtsystem.fradetskoleadministrativesystemet kommerskoleåretsfag,medtilhørendefaglærerogelever,mens karaktererogfraværgårdenandreveien. Supplérmedtekst.Kontekstdiagrammetisegselvgirengodoversikt integrasjonene,mendetsierikkesåmyeomhvadeulikesystemene Læringsplattform Skoleadministrativt system Brukeradministrativt system Feide Rolle Identitet Fag Karakter Fravær Brukti Behovsanalyse s. 8

19 Kravspesifisering s.19av54 eroghvaslagsdatadetegentligersombevegersegmellom systemene.derforbørmanleggetiltotabeller,etmednavnog beskrivelsepåsystemenesommanskalintegreresegmotogetmed navnogbeskrivelsepådeuliketypedatasomskalflytemellom systemene. Filer Fil Kontekstdiagram EksempelLMS.docx Kontekstdiagram EksempelDLR.docx Kontekstdiagram MalLMS.docx Kontekstdiagram MalDLR.docx Type Eksempel Eksempel Mal Mal Kontekstdiagram - Kontekstdiagram - Eksempel LMS.docx Eksempel DLR.docx Kontekstdiagram - Mal LMS.dotx Kontekstdiagram - Mal DLR.dotx

20 Kravspesifisering Aktivitet KRAVANALYSE Dereskalanskaffeendigitallæringsplattform(LMS Learning ManagementSystem)ellerendigitallæringsressurs.Etter behovsanalysenvetduhvorforduharbehovforløsningenoghvilke kravdenmåtilfredsstilleforatduskaloppnåmålenedine. IT1systemkanværekomplekse.Foråkunnegiethelhetligbilde,bør mansepådetfraulikeperspektiv.zachman1rammeverketangirseks ulike,somgirsvarpådevanligstespørreordenevåre: vem? vordan? va? Når? vorfor? vor? Behovsanalysenkangjøresitrestegsomskissertifigurenovenfor. 1. Modellér adferd s.20av54 Prosess Kravspesifisering s. 3 Input Omfangsbeskrivelse s. 12 Teknisk plattform s. 14 Output Kravmodell s. 22 Verktøy Brukstilfeller s. 29 Brukerhistorier s. 23 Konsept- og datamodeller s. 36 Lesmer «User Stories Applied» av Mike Cohn. Addison-Wesley Professional; 2004; 304 sider. «Writing Effective Use Cases» av Alistair Cockburn. Addison-Wesley Professional; 2000; 304 sider. «Applying UML and Patterns» av Craig Larman. 3. utgave. Prentice all; 2004; 736 sider. «Business Rules Applied: Building Better Systems Using the Business Rules Approach» av Babara von alle. Wiley; 2001; 592 sider. 3.Beskriv andre aspekter 2. Modellér begreper Figur5Kravanalyse Ipraksisarbeidermanideulikeperspektivenesamtidig.Vedåsepå systemetietperspektiv,oppdagermantingåbeskriveideandre perspektivene. Modelléradferd Førstesteggirsvarpådetoførstespørsmålene:hvembruker systemetoghvordanskaldebrukedet?topopulæremåterågjøre detpåerbrukstilfellerogbrukerhistorier.visduskalforetaen fullstendigkravanalyse,erbrukstilfellerdetbestealternativet.ønsker duderimotåbrukesmidigemetoder,åutsettedendetaljerteanalysen tilimplementeringstidspunktet,erbrukerhistorieretgodtalternativ.

21 Kravspesifisering s.21av54 Modellérbegreper Andresteggirsvarpåhva,begrepeneogdataenesomskalhåndteres avsystemet.detgirendefinisjonavbegrepeneogbeskriverhvordan dehengersammen. Beskrivandreaspekter Sistesteggirsvarpådesistetreperspektivene: Når skal systemet brukes? endelser som utløser handling. vorfor? Forretningsregler. vor? Lokasjoner der systemet skal brukes hvis relevante forskjeller. endelserhengersammenmedadferdogdata.endelserkanutløse etbrukstilfelleoghengeroftesammenmedentilstandsendringfor data.endelsererspesieltinteressantevedautomatisering,derting skalskjeisystemetutenatdetinitieresavenbruker. Forretningsreglerbliroftebeskrevetsomendelavsystemadferden, mendeterbedreåbeskrivedemseparat.påsammemåtesomen begrepsmodellgjøratmanikketrengerådefinerebegrepenepånytti hvertbrukstilfelle,kanmanslippeåbeskrivedensamme forretningsregelenflereganger.forretningsreglerbeskriverfor eksempelberegningellerhvordanbeslutningerskalgjøres.den vanligstemåtenåbeskriveforretningsreglerervedhjelpavpresis norskellerbeslutningstabeller. Lokasjonererhvorsystemetskalbrukes,foreksempelhvaslagstype enhetbrukernebrukerideulikebrukstilfelleneelleromdebefinner seginnenforellerutenforintranettet.foreksempelkandetværeat detåleseogspilleavundervisningsmateriellskalkunnegjørespå nettbrett,mendetåredigerebaretrengeråkunnegjørespåenpc.

22 Kravspesifisering Leveranse KRAVMODELL Kravmodellenerdenviktigsteleveransenfrakravanalysen.Deteren modellavulikeaspektervedløsningensomskalanskaffes. Kravmodellentasmedibilag1 kundenskravspesifikasjonistatens standardavtaler(ssa) 4. Kravmodellenbeståravdetfølgende: Adferdsmodell som beskriver brukere og bruk av systemet Begreps- eller datamodell som beskriver begrepene, dataene og hvordan de relaterer seg til hverandre Forretningsregler, hendelser og lokasjoner s.22av54 Inputtil Kravutforming s. 43 Outputfra Kravanalyse s. 20 Filer Fil Kravmodell EksempelLMS.docx Kravmodell EksempelDLR.docx Type Eksempel Eksempel Kravmodell - Eksempel LMS.docx Kravmodell - Eksempel DLR.docx 4

23 Kravspesifisering Verktøy BRUKERISTORIER Duskalutarbeideenkravspesifikasjonsomskalbrukestilåanskaffe enløsningsomskalutviklesvedhjelpavensmidigellerleanmetode. Kravspesifikasjonenvilbliendelavavtalenogdeterviktigatden utformetpåenmåtesompassergodtmedhvordanmanskalarbeide. Brukerhistoriererenmyebenyttetmetodeforåangiarbeidetsom skalutføresismidigeprosjekter. s.23av54 Brukti Kravanalyse s. 20 Lesmer «User Stories Applied» av Mike Cohn. Addison- Wesley Professional; 2004; 304 sider. Brukerhistoriererennedbrytningavarbeidet Utifranavneterdetikkemyesomskillerenbrukerhistoriefraet brukstilfelle.deharogsånoeheltsentralttilfelles:deuttrykkerbegge målbrukereønskeråoppnåvedbrukavløsningen.likeveldreierdet segomnoeheltforskjellig.brukstilfellergirdegdokumentasjonav adferdentiletsystem;brukerhistoriererpåminnelseromhvilket arbeidsomskalgjøresiprosjektet.setabellennedenforforflere forskjeller. Brukstilfeller Brukerhistorier Modelleringsverktøysombrukes tilåanalysereogdokumentere adferdentiletsystem. Grupperingavbeslektet funksjonalitet. Kanbeskrivesstrukturertog kontrolleresforkonsistensog kompletthet. Livssyklusdokumentasjon. Nedbrytningavarbeidetsom skalutføresiprosjektet. Enenkeltegenskapsomskal utvikles. Alltiduformell. Påminnelseomarbeidog samtalersommåholdes. Tabell1Forskjellerbrukerhistorierogbrukstilfeller Passerforinkrementellutvikling Ismidigemetoderskalmanhahyppigeleveranseravetpotensielt leveringsklartprodukt.ileanskalmanhadetkontinuerlig.produktet leveresiinkrementeristedetforsamlettilslutt.detteharnaturlig nokkonsekvenserforhvordanmanbryternedarbeidetiprosjektet. Entradisjonellnedbrytningifaserettertypearbeid(analyse,design, utvikling,test )erikkehensiktsmessig. Nedbrytningenbøristedetskjeetteregenskaperiproduktetog inkluderealtarbeidsomskaltilforåleveredenegenskapeniet inkrement.enbrukerhistorieernettoppenslikarbeidspakke.

24 Kravspesifisering s.24av54 Brukesiplanlegging Brukerhistorierbrukestilplanleggingavetprosjekt.Debrukestilå estimereinnsatsensomernødvendigogtilåleggearbeidetutitid.i smidigeprosjektergjøresdetteiterativt.manharulike planleggingshorisonter,arbeidetsomskalutføresidennærmeste fremtiderspesifisertidetalj,mensarbeidsomskalutføreslenger fremitidharmankunoversiktoverpåetoverordnetnivå. Dettekanløsesvedåhabrukerhistorieravulikestørrelser.Eposer brukerhistoriersomangirenstordelavsluttproduktet.enenkelt brukerhistorieernoeavrettstørrelsetilåleveresforseg.et eksempelpåeteposkanvære: «Somenfaglærerønskerjegåkunnelagearbeidsplanerslikatjegog elevenevethvadeskalgjørehverukegjennomåreneforåoppnå læringsmåleneidenlokalelæreplanen.» Eteksempelpåenenkeltbrukerhistoriekanvære: «Somenfaglærerønskerjegåkunneleggetiletemneienarbeidsplan slikatdeterlettåfåoversiktoverarbeidetsomskalgjøres.» Etterhvertsommanprosjektetstigerfremvilmanpleieproduktkøen medallebrukerhistorienogblantannetforetaengradvisutdypning avomfangetvedåbrytestoreeposnedimindreeposognedtil individuellebrukerhistorier.iscrum,ensmidigmetode,vilman typiskvedoppstartenavensprintbrytenedbrukerhistorienesom skalimplementeresnedienkelteoppgaver. Enpåminnelseomfremtidigesamtaler Enbrukerhistorieermerenpåminnelseomsamtalermanmåhai fremtidenenndokumentasjon.dettebetyratbrukerhistoriererbest egnetderkundenellerprodukteierertilgjengeligforutviklerneog harmulighettilrasktåkommemedavklaringerogbeslutninger.selve dokumentasjonenavkravenetilløsningenliggeritestenesomskal kjøresforågodkjenneden,akseptansekriteriene. Sliklagerdubrukerhistorier Begynnmedbrukerne Detmanbegynnermederåidentifiserebrukerne.Dettegjørmansom regelvedåibeskriveroller.eksemplerpåmuligerolleriskolener: Elev Faglærer Fagleder Kontaktlærer Foresatt Systemadministrator

LMS - Kravspesifisering. Anna Borg Senter for IKT i utdanningen

LMS - Kravspesifisering. Anna Borg Senter for IKT i utdanningen LMS - Kravspesifisering Anna Borg Senter for IKT i utdanningen ab@iktsenteret.no Senter for IKT i utdanningen https://iktsenteret.no/ Veileder for kravspesifisering Hvorfor har vi laget den Hva den består

Detaljer

Kravhåndtering. INF1050: Gjennomgang, uke 03

Kravhåndtering. INF1050: Gjennomgang, uke 03 Kravhåndtering INF1050: Gjennomgang, uke 03 Kompetansemål Kravhåndtering Anvende metoder og teknikker for å Innhente / Analysere / Spesifisere krav Ulike typer krav Funksjonelle krav Ikke-funksjonelle

Detaljer

Kapittel 7 & 8. Kravspesifikasjoner & Data design. Thomas Tjøstheim og Thomas Edvinsen. 20 September Kapittel 7 & 8 p.1/20

Kapittel 7 & 8. Kravspesifikasjoner & Data design. Thomas Tjøstheim og Thomas Edvinsen. 20 September Kapittel 7 & 8 p.1/20 Kapittel 7 & 8 p.1/20 Kapittel 7 & 8 Kravspesifikasjoner & Data design Thomas Tjøstheim og Thomas Edvinsen 20 September 2004 Kapittel 7 & 8 p.2/20 Introduksjon Kravspesifikasjoner består av to underdeler:

Detaljer

I dag UML. Domenemodell visualisering av konsepter. Eksempel. Hvordan finne domeneklasser?

I dag UML. Domenemodell visualisering av konsepter. Eksempel. Hvordan finne domeneklasser? UML Use case drevet analyse og design 31.01.2005 Kirsten Ribu I dag Domenemodell (forløper til klassediagram) Interaksjonsdiagrammer Sekvensdiagram Kollaborasjonsdiagram 1 2 Domenemodell visualisering

Detaljer

Modellering av krav. INF1050: Systemutvikling 11. februar 2015. Universitetslektor Yngve Lindsjørn

Modellering av krav. INF1050: Systemutvikling 11. februar 2015. Universitetslektor Yngve Lindsjørn INF1050: Systemutvikling 11. februar 2015 Modellering av krav Universitetslektor Yngve Lindsjørn INF1050 ->Systemutvikling-> Modellering av krav / Yngve Lindsjørn 1 Temaer i dagens forelesning Modellering

Detaljer

UKE 11 UML modellering og use case. Gruppetime INF1055

UKE 11 UML modellering og use case. Gruppetime INF1055 UKE 11 UML modellering og use case Gruppetime INF1055 Hva skal vi i dag? Analyse og design - kapittel 5 og 7 UML modellering Ukesoppgaver 3: Modellering av krav UML UML Kompetansemål Modellering av krav

Detaljer

Modellering av krav. INF1050: Systemutvikling 07. februar Førstelektor Yngve Lindsjørn

Modellering av krav. INF1050: Systemutvikling 07. februar Førstelektor Yngve Lindsjørn INF1050: Systemutvikling 07. februar 2017 Modellering av krav Førstelektor Yngve Lindsjørn INF1050 ->Systemutvikling-> Modellering av krav / Yngve Lindsjørn 1 Temaer i dagens forelesning Modellering av

Detaljer

Vurdering av læringsplattformer

Vurdering av læringsplattformer Vurdering av læringsplattformer Bruk av ulike læringsplattformer er nok kommet for å bli. Flere og flere kommuner arbeider aktivt for bruk læringsplattformer i skolene. Ofte er et også kommunene som bestemmer

Detaljer

UML 1. Use case drevet analyse og design. 20.01.2004 Kirsten Ribu

UML 1. Use case drevet analyse og design. 20.01.2004 Kirsten Ribu UML 1 Use case drevet analyse og design 20.01.2004 Kirsten Ribu 1 I dag Domenemodell (forløper til klassediagram) Interaksjonsdiagrammer Sekvensdiagram Kollaborasjonsdiagram 2 Domenemodell visualisering

Detaljer

Use Case-modellering. INF1050: Gjennomgang, uke 04

Use Case-modellering. INF1050: Gjennomgang, uke 04 Use Case-modellering INF1050: Gjennomgang, uke 04 Kompetansemål Modellering av krav Kunne modellere ulike typer krav UML-diagrammer Innføring i grunnleggende UML-modellering Bruksmønster (use case) Sekvensdiagram

Detaljer

Eksamen INF

Eksamen INF Eksamen INF5120 06.06.2005 Et løsningsforslag Oppgave 1 a) Business Model Oppgaven spør om en business model for samhandlingen mellom Buyer og Seller, og det er da viktig å ikke modellere alt det andre!!!

Detaljer

OptimalJ-kurs UIO Oppsummering av kurset. De ulike modellene egenskaper og formål

OptimalJ-kurs UIO Oppsummering av kurset. De ulike modellene egenskaper og formål OptimalJ-kurs UIO 2004 Agenda Time 1: Oppsummering av kurset Time 2: De ulike modellene egenskaper og formål Team Development med OptimalJ Domain Patterns Egenutviklede transformasjoner (krever Architect

Detaljer

«For akkurat som når jeg legger et puslespill og plukker en tilfeldig brikke fra haugen av brikker, så kaster jeg ikke brikken bare fordi den hører

«For akkurat som når jeg legger et puslespill og plukker en tilfeldig brikke fra haugen av brikker, så kaster jeg ikke brikken bare fordi den hører «For akkurat som når jeg legger et puslespill og plukker en tilfeldig brikke fra haugen av brikker, så kaster jeg ikke brikken bare fordi den hører til midt i bildet og ikke nær rammen der jeg har begynt

Detaljer

Kan bruk av Learning Managment System differensiere undervisningen og øke elevenes læringsutbytte? Prosjekt: Presentasjon Av Elin Blikra

Kan bruk av Learning Managment System differensiere undervisningen og øke elevenes læringsutbytte? Prosjekt: Presentasjon Av Elin Blikra Kan bruk av Learning Managment System differensiere undervisningen og øke elevenes læringsutbytte? Prosjekt: Presentasjon Av Elin Blikra Videreutdanning i databehandling Hovedprosjekt Nettstudie Høgskolen

Detaljer

Tom Røise 26.02.2007. IMT2243 : Systemutvikling 1. IMT2243 Systemutvikling 26. februar 2007. Klassediagrammet. Klasse

Tom Røise 26.02.2007. IMT2243 : Systemutvikling 1. IMT2243 Systemutvikling 26. februar 2007. Klassediagrammet. Klasse IMT2243 Systemutvikling 26. februar 2007 Tema : Domenemodellering og Kravspeken - Repetisjon konseptuelle klassediagram - Eksempler - konseptuelle klassediagram (IHID løsningen og OL-Veiviseren) - Maler

Detaljer

En unik læringsplattform inspirert av sosiale medier

En unik læringsplattform inspirert av sosiale medier En unik læringsplattform inspirert av sosiale medier 905 36 325 www.nectarlearning.com Innlogginger på kveldene og i helgene - beste attesten vi kan få! Tenk deg en læringsplattform for elevear, lærere,

Detaljer

ARK 2014 Arkitekturfaget - observasjon fra en tjenesteleverandør

ARK 2014 Arkitekturfaget - observasjon fra en tjenesteleverandør ARK 2014 Arkitekturfaget - observasjon fra en tjenesteleverandør www.steria.com Stein Aarum Leder for arkitekturfagområdet Steria www.steria.com Innhold Hva vi mener med arkitektur Vår viktigste rolle

Detaljer

Kravspesifiseringsprosessen

Kravspesifiseringsprosessen IMT2243: 18.februar 2010 DAGENS : Metoder for å få kartlagt de Funksjonelle kravene Strukturert Analyse den gamle måten og gjøre det på (dette foilsettet + wikipedia-omtalen er eneste pensum innen SA)

Detaljer

Oslo kommune. Utdanningsetaten. itslearning i Osloskolen - veiledning for lærere. Vurderingsoversikt. August 2015

Oslo kommune. Utdanningsetaten. itslearning i Osloskolen - veiledning for lærere. Vurderingsoversikt. August 2015 itslearning i Osloskolen - veiledning for lærere Vurderingsoversikt August 2015 Vurderingsoversikt I hvert fag finnes en vurderingsoversikt som er tilgjengelig for elev, foresatt og faglærer. Vurderingsoversikten

Detaljer

Bruk av Fronter i vurderingsarbeidet. Ann Kathrin B Aasen og Geir Kristiansen, Veggli skole

Bruk av Fronter i vurderingsarbeidet. Ann Kathrin B Aasen og Geir Kristiansen, Veggli skole Bruk av Fronter i vurderingsarbeidet VEGGLI SKOLE er en 1-10 skole SFO 159 elever 26 lærere 5 assistenter Alle elever på alle trinn har egen pc Smartboard i alle klasserom Trådløst nett på hele skolen

Detaljer

Introduksjon til fagfeltet

Introduksjon til fagfeltet LC238D http://www.aitel.hist.no/fag/_dmdb/ Introduksjon til fagfeltet Datafiler side 2 Databasesystemer side 3-5 Databasearkitektur ANSI/SPARC side 6-7 Datamodeller side 8 Flerbruker databasesystem side

Detaljer

Use case modellen. Use case modellering i analysefasen. Hva er en Aktør? Hva er et Use case? Use case modellering. Eksempel

Use case modellen. Use case modellering i analysefasen. Hva er en Aktør? Hva er et Use case? Use case modellering. Eksempel Use case modellen Use case modellering i analysefasen Metode for å identifisere og beskrive de funksjonelle kravene til et system Kapittel 3 i UML Distilled Kirsten Ribu beskriver kravene til systemet,

Detaljer

Kravspesifikasjon med UML use case modellering. Erik Arisholm 25.02.2009

Kravspesifikasjon med UML use case modellering. Erik Arisholm 25.02.2009 Kravspesifikasjon med UML use case modellering Erik Arisholm 25.02.2009 Unified Modeling Language (UML) Notasjon som støtter opp under modellbasert systemutvikling objektorientert analyse ( hva systemet

Detaljer

1. Presentasjon av prosjekt. Forord

1. Presentasjon av prosjekt. Forord 1. Presentasjon av prosjekt Forord Dette prosjektet har strukket seg over et semester på Høgskolen i Oslo og Akershus, institutt for Informasjonsteknologi. Prosjektet har vært et utfordrende, men samtidig

Detaljer

SKRIFTLIG VURDERING PÅ BARNETRINNET

SKRIFTLIG VURDERING PÅ BARNETRINNET Skolens navn: Adresse: Telefon/faks: SKRIFTLIG VURDERING PÅ BARNETRINNET Elevens navn Gruppe og skoleår _ Vurderingen er gjennomgått i samtale: (dato) Underskrift elev Underskrift foresatt Underskrift

Detaljer

John-Kjell.Hoset@Stretch.no 9513 5625 EN INNFØRING I BPM

John-Kjell.Hoset@Stretch.no 9513 5625 EN INNFØRING I BPM John-Kjell.Hoset@Stretch.no 9513 5625 EN INNFØRING I BPM 1 AGENDA DEL1 HVA ER BPM Hva er BPM Utfordringen Gruppearbeid DEL2 PRAKTISK MODELLERING OG DEMO MED BIZAGI Hva er BPMN BPMN modellering verktøy

Detaljer

Prøv å skrive alle svar på alle spørsmål i det tomme rom i disse sidene. Hvis du trenger mer plass, bruk ekstra sider.

Prøv å skrive alle svar på alle spørsmål i det tomme rom i disse sidene. Hvis du trenger mer plass, bruk ekstra sider. 1 For hver del, alle sub deler teller likt. Prøv å skrive alle svar på alle spørsmål i det tomme rom i disse sidene. Hvis du trenger mer plass, bruk ekstra sider. For hvert spørsmål, hvis du trenger å

Detaljer

Kunnskapsdepartementet ønsker en sikker identifisering av elever og lærere. Løsningen er Feide (Felles Elektronisk IDEntitet)

Kunnskapsdepartementet ønsker en sikker identifisering av elever og lærere. Løsningen er Feide (Felles Elektronisk IDEntitet) Kunnskapsdepartementet ønsker en sikker identifisering av elever og lærere Løsningen er Feide (Felles Elektronisk IDEntitet) Senter for IKT i utdanningen har et ansvar for innføring av Feide i grunnopplæringa

Detaljer

Kundens tekniske plattform

Kundens tekniske plattform Kundens tekniske plattform Statens vegvesen IKT-avdelingen Versjon: 1.1 27.02 2015 Status: Godkjent Side 1 av 5 Innhold 1 Innledning 2 Teknisk plattform 2.1 Interne miljøer 2.1.1 Systemtest (UTV) 2.1.2

Detaljer

Løsningsforslag til Case. (Analysen)

Løsningsforslag til Case. (Analysen) Løsningsforslag til Case (Analysen) Dette er en skisse til løsning av Case et med bussinformasjonssystemet. Jeg kaller det en skisse fordi det på den ene siden ikke er noe fasitsvar og fordi løsningen

Detaljer

Utarbeidelse av kravspesifikasjon for anskaffelse av NOARK system

Utarbeidelse av kravspesifikasjon for anskaffelse av NOARK system Utarbeidelse av kravspesifikasjon for anskaffelse av NOARK system Mars 2013 Astrid Øksenvåg Om EKOR Konsulenthus spesialisert på informasjonsforvaltning Bistår kunder med: Behovskartlegging Kravspesifisering

Detaljer

Obligatorisk oppgave 1: Foranalyse og Kravhåndtering Lars- Martin Hejll 5611 Systemutvikling

Obligatorisk oppgave 1: Foranalyse og Kravhåndtering Lars- Martin Hejll 5611 Systemutvikling Obligatorisk oppgave 1: Foranalyse og Kravhåndtering LarsMartin Hejll 5611 Systemutvikling Høgskolen i Telemark Oppgave 1: Bakgrunn for systemet LarsMartin Hejll A) Ved å sentralisere bookingsystemet til

Detaljer

LEAN. Kontinuerlig forbedring. Aktivitet. / arbeidsprosessa. Verdistrøm. Sløsing. Fokusintervju. Problemtre. Interessentanalyse.

LEAN. Kontinuerlig forbedring. Aktivitet. / arbeidsprosessa. Verdistrøm. Sløsing. Fokusintervju. Problemtre. Interessentanalyse. Kontinuerlig forbedring ord og uttrykk: LEAN Kontinuerlig forbedring Aktivitet Verdistrøm / arbeidsprosessa Sløsing Fokusintervju Problemtre Interessentanalyse Brunpapirsesjon Hvitpapirsesjon Forbedringsforslag

Detaljer

Tromsø maritime skole. V-S-Lokal læreplan Vg2, prosjekt til fordypning, Kulde- og varmepumpeteknikkfaget

Tromsø maritime skole. V-S-Lokal læreplan Vg2, prosjekt til fordypning, Kulde- og varmepumpeteknikkfaget Tromsø maritime skole V-S-Lokal læreplan Vg2, prosjekt til fordypning, Kulde- og varmepumpeteknikkfaget Utgave: 3.00 Skrevet av: Odd Isaksen / Rolf M. Nilsen Gjelder fra: 19.11.2009 Godkjent av: Snorre

Detaljer

Inception Elaboration Construction Transition Bemanning 1 1,5 2 2 Varighet i uker Antall iterasjoner (lengde i uker i parentes) Tabell 1

Inception Elaboration Construction Transition Bemanning 1 1,5 2 2 Varighet i uker Antall iterasjoner (lengde i uker i parentes) Tabell 1 Innhold Innledning... 2 Faseplan... 2 Iterasjonsplanlegging... 3 Oppstartsfasen... 3 Artefaktene i oppstartsfasen... 4 Utdypingsfasen... 5 Konstruksjonsfasen... 5 Overføringsfasen... 6 Litteratur... 7

Detaljer

Strategiplan pedagogisk IKT 2011-2014

Strategiplan pedagogisk IKT 2011-2014 Strategiplan pedagogisk IKT 2011-2014 Bakgrunn Planen er en videreføring av Strategiplan pedagogisk bruk av IKT 2008 2011 og bygger på den samme forståelse av hva pedagogisk IKT-kompetanse er, og hvordan

Detaljer

UKEOPPGAVER 2: SYSTEMUTVIKLINGSPROSESSER OG PROSJEKTARBEID INNSPILL TIL SVAR

UKEOPPGAVER 2: SYSTEMUTVIKLINGSPROSESSER OG PROSJEKTARBEID INNSPILL TIL SVAR INF 1050 UKEOPPGAVER 2: SYSTEMUTVIKLINGSPROSESSER OG PROSJEKTARBEID INNSPILL TIL SVAR Oppgave 1 a) Foranalyse: Foranalysen kan med fordel gjøres i to trinn. Den første er å undersøke finansiering og øvrige

Detaljer

Grafisk løsning av ligninger i GeoGebra

Grafisk løsning av ligninger i GeoGebra Grafisk løsning av ligninger i GeoGebra Arbeidskrav 2 Læring med digitale medier 2013 Magne Svendsen, Universitetet i Nordland Innholdsfortegnelse INNLEDNING... 3 GRAFISK LØSNING AV LIGNINGER I GEOGEBRA...

Detaljer

AMS-case. Eksemplifisering av modellbasert. tilnærming til design av brukergrensesnitt

AMS-case. Eksemplifisering av modellbasert. tilnærming til design av brukergrensesnitt AMS-case Eksemplifisering av modellbasert tilnærming til design av brukergrensesnitt Domenemodell Sentrale begreper og relasjoner Utgangspunkt for både oppgave- og dialogmodeller Mange muligheter kan undersøkes

Detaljer

Norsk for elever med samisk som førstespråk - veiledning til læreplanen

Norsk for elever med samisk som førstespråk - veiledning til læreplanen Norsk for elever med samisk som førstespråk - veiledning til læreplanen Eksempel 3: Skrive en digital tekst med hyperkoplinger 5. 7. årstrinn I læreplanen blir begrepet sammensatte tekster brukt i forbindelse

Detaljer

SOLVANG SKOLES PEDAGOGISKE UTVIKLINGSPLAN 2014/2015

SOLVANG SKOLES PEDAGOGISKE UTVIKLINGSPLAN 2014/2015 SOLVANG SKOLES PEDAGOGISKE UTVIKLINGSPLAN 2014/2015 Vår visjon: Nasjonale satsingsområder: Kommunale satsingsområder: Hamarskolen som merkevare Kunnskap til styrke Økt læringsutbytte og grunnleggende ferdigheter

Detaljer

Kontrakter og test i smidige prosjekter. Fagmøte Dataforeningen i Trondheim 12.Mars 2012

Kontrakter og test i smidige prosjekter. Fagmøte Dataforeningen i Trondheim 12.Mars 2012 Kontrakter og test i smidige prosjekter Fagmøte Dataforeningen i Trondheim 12.Mars 2012 Agenda Smidige manifest Smidige prosjekter og testing Samarbeid og tillit teori Hva er en kontrakt Gjennomgang av

Detaljer

AGENDA. Faseinndeling og leveranser Leveransemodell Prosjektplan utkast Arkitekturområder Interessenter og roller

AGENDA. Faseinndeling og leveranser Leveransemodell Prosjektplan utkast Arkitekturområder Interessenter og roller AGENDA 01 02 03 04 05 Faseinndeling og leveranser Leveransemodell Prosjektplan utkast Arkitekturområder Interessenter og roller Leveransemodell Faser og leveranseinndeling Oppstart Revidert prosjektplan

Detaljer

NOVUG 3 februar 2009

NOVUG 3 februar 2009 NOVUG 3 februar 2009 Tjenestekatalog og CMDB En kombinasjon som fungerer i praksis 2008 Prosesshuset AS All tillhørende informasjon kan bli endret uten varsel 1 Introduksjon Stig Bjørling Ellingsen Gründer

Detaljer

Teknologiforum, Clarion hotel, Gardermoen 2015-10-26/27. En introduksjon til SOSI del 1 Regler for UML modellering

Teknologiforum, Clarion hotel, Gardermoen 2015-10-26/27. En introduksjon til SOSI del 1 Regler for UML modellering Teknologiforum, Clarion hotel, Gardermoen 2015-10-26/27 SOSI versjon 5.0 Morten Borrebæk Kartverket En introduksjon til SOSI del 1 Regler for UML modellering (fra forretningsprosesser til tjenestemodeller)

Detaljer

2. Beskrivelse av mulige prosjektoppgaver

2. Beskrivelse av mulige prosjektoppgaver Avanserte databaser (øving 9, 10, 11 & 12) Tore Mallaug 25.01.2008 Opphavsrett:Forfatter og Stiftelsen TISIP Lærestoffet er utviklet for faget LO326D Avanserte Databaser INNLEVERINGSFRISTER (Obligatorisk

Detaljer

Prosjektrettet systemarbeid

Prosjektrettet systemarbeid Prosjektrettet systemarbeid Funksjonsmodellering Faglærer: Kjell Toft Hansen Funksjonsmodellering Fra prosjektets brukerkravdokument: Kap. 3.1 Krav til funksjoner Kravene til funksjoner beskriver hva bruker

Detaljer

PC som hjelpemiddel i grunnskolen i Bærum kommune - informasjon til elever og foresatte

PC som hjelpemiddel i grunnskolen i Bærum kommune - informasjon til elever og foresatte Revidert 05.02.09 PC som hjelpemiddel i grunnskolen i Bærum kommune - informasjon til elever og foresatte Til foresatte og elever som har fått vedtak om pc som hjelpemiddel Når dere nå skal velge en pc

Detaljer

UKE 13 Mer UML modellering. Gruppetime INF1055 Julie Hagen Nilsen & Maria Stolinski

UKE 13 Mer UML modellering. Gruppetime INF1055 Julie Hagen Nilsen & Maria Stolinski UKE 13 Mer UML modellering Gruppetime INF1055 Julie Hagen Nilsen & Maria Stolinski Hva skal vi i dag? Objektorientert design - kapittel 5 og 7 UML modellering Aktivitetsdiagrammer Klassediagram Ukesoppgaver

Detaljer

Telenors satsing på fri programvare Paul Skrede - GoOpen 2009

Telenors satsing på fri programvare Paul Skrede - GoOpen 2009 Telenors satsing på fri programvare Paul Skrede - GoOpen 2009 Oppsummert Telenor går tydelig inn for fri programvare Telenor har valgt evolusjonær metode De ansatte og våre utviklingsleverandører er med

Detaljer

Hvordan måle besparelser ved innføring av nye applikasjoner eller endringer i funksjonalitet?

Hvordan måle besparelser ved innføring av nye applikasjoner eller endringer i funksjonalitet? Notat 11.08.2016 KFH Hvordan måle besparelser ved innføring av nye applikasjoner eller endringer i funksjonalitet? Notatet er basert på Veileder Gevinstrealisering planlegging for å hente ut gevinster

Detaljer

Kap3: Klassemodellering

Kap3: Klassemodellering Kap3: Klassemodellering I dag: Litt repetisjon fra sist (innledende om klassemodellen) Deretter egentlig litt mer repetisjon, men nå fra intro- Felt-/Instansvariabler og kurset i Java: Klasser og Objekt,

Detaljer

Vurdering FOR læring. 30.01.2012 Charlotte Duesund

Vurdering FOR læring. 30.01.2012 Charlotte Duesund Vurdering FOR læring MÅL FOR DAGEN: Jeg kan skape liv i læringsmålene Jeg kan utarbeide kriterier på ulike måter Jeg kan gi ulike former for tilbakemelding Jeg kan bruke den informasjonen jeg får i videre

Detaljer

Tom Røise 18. Februar 2009

Tom Røise 18. Februar 2009 Forelesning IMT2243 18. Februar 2009 Tema : Kravspesifisering : litt mer om prosessen Viewpoint en myk tilnærming Use Case en scenariebasert teknikk innen metoden Objektorientert Analyse brukes til å avklare

Detaljer

SWOT for skoleeier. En modell for å analysere skoleeiers situasjon og behov

SWOT for skoleeier. En modell for å analysere skoleeiers situasjon og behov 1 SWOT for skoleeier En modell for å analysere skoleeiers situasjon og behov 2 1 Aktivt skoleeierskap og kvalitetsvurdering Nasjonal, kommunal og skolebasert vurdering gir skole- og kommunenivået forholdsvis

Detaljer

RAMNESMODELLEN. Vedtatt i SU 06.03.12. Ramnes skole har fokus på trivsel og læring

RAMNESMODELLEN. Vedtatt i SU 06.03.12. Ramnes skole har fokus på trivsel og læring RAMNESMODELLEN Vedtatt i SU 06.03.12 Ramnes skole har fokus på trivsel og læring OVERORDNEDE MÅLSETTINGER Trygghet for alle, både elever og ansatte. Høyt faglig trykk/nivå slik at elevene får utnyttet

Detaljer

Brukermanual for lærere - hypernet Fravær

Brukermanual for lærere - hypernet Fravær Brukermanual for lærere - hypernet Fravær Manual hypernet Fravær 1 Manual for lærere - hypernet Fravær Innhold Føring av fravær... 3 Finn riktig klasse... 3 Føre fravær på en eller flere elever... 4 Registrering

Detaljer

Hva vet vi om utfordringer og behov rundt personvernhåndtering? En oppsummering av resultater fra en intervjuundersøkelse

Hva vet vi om utfordringer og behov rundt personvernhåndtering? En oppsummering av resultater fra en intervjuundersøkelse Hva vet vi om utfordringer og behov rundt personvernhåndtering? En oppsummering av resultater fra en intervjuundersøkelse Aida Omerovic 4. Mai 2016 Seminar: Personvern forordninger og press på forretningsmodeller

Detaljer

Tilmelding med pedagogisk rapport til pedagogisk psykologisk tjeneste for elever i grunnskole

Tilmelding med pedagogisk rapport til pedagogisk psykologisk tjeneste for elever i grunnskole Tilmelding med pedagogisk rapport til pedagogisk psykologisk tjeneste for elever i grunnskole Før en eventuell tilmelding til PPS skal skolen vurdere elevenes behov. Med utgangspunkt i egen kompetanse

Detaljer

GJENNOMGANG OBLIGATORISK OPPGAVE 1

GJENNOMGANG OBLIGATORISK OPPGAVE 1 GJENNOMGANG OBLIGATORISK OPPGAVE 1 INF1050 V16 KRISTIN BRÆNDEN 1 Systemet for utleie av markasykler ønsker a benytte seg av en eksisterende betalingsløsning, og valget har falt pa det samme betalingssystemet

Detaljer

Kunnskapsdepartementet ønsker en sikker identifisering av elever og lærere. Løsningen er Feide (Felles Elektronisk IDEntitet)

Kunnskapsdepartementet ønsker en sikker identifisering av elever og lærere. Løsningen er Feide (Felles Elektronisk IDEntitet) Kunnskapsdepartementet ønsker en sikker identifisering av elever og lærere Løsningen er Feide (Felles Elektronisk IDEntitet) Senter for IKT i utdanningen har et ansvar for innføring av Feide i grunnopplæringa

Detaljer

Bilag 2 til konkurransegrunnlag del II: Kravspesifikasjon

Bilag 2 til konkurransegrunnlag del II: Kravspesifikasjon ilag 2 til konkurransegrunnlag del II: Kravspesifikasjon Side 1 av 10 Kravspesifikasjon I 2008 startet et prosjekt for å etablere et felles skoleadministrativt system for grunnskole, SFO og barnehage.

Detaljer

Gjelder fra: 19.08.2014. Godkjent av: Fylkesrådet

Gjelder fra: 19.08.2014. Godkjent av: Fylkesrådet Dok.id.: 1.3.1.7.0 Metode beskrivelse av arbeidsprosess og risiko- og Utgave: 1.00 Skrevet av: Camilla Bjørn Gjelder fra: 19.08.2014 Godkjent av: Fylkesrådet Dok.type: Styringsdokumenter Sidenr: 1 av 7

Detaljer

Nyttestyring og gode brukerhistorier. Stein Grimstad, 25.august, ITPP

Nyttestyring og gode brukerhistorier. Stein Grimstad, 25.august, ITPP Nyttestyring og gode brukerhistorier Stein Grimstad, 25.august, ITPP Presentasjonen er basert på egne erfaringer, forskning, erfaringsrapporter og diskusjoner med fagpersoner Oppdrag som produkteier og/eller

Detaljer

Use case modellen. Use case modellering i analysefasen. Hva er en Aktør? Hva er et Use case?

Use case modellen. Use case modellering i analysefasen. Hva er en Aktør? Hva er et Use case? 1/15/2004 1 Use case modellen Use case modellering i analysefasen Metode for å identifisere og beskrive de funksjonelle kravene til et system Kapittel 3 i UML Distilled Kapittel 8 i Gurholt og Hasle Kirsten

Detaljer

Læreplaner og kartleggingsverktøy for språklige minoriteter

Læreplaner og kartleggingsverktøy for språklige minoriteter Læreplaner og kartleggingsverktøy for språklige minoriteter Likeverdig opplæring i praksis. Språklig mangfold og likeverdig Kristiansand 17.- 18.09.08 Else Ryen NAFO Læreplaner Arbeid med tilrettelegging

Detaljer

Arbeidsprosessanalyse

Arbeidsprosessanalyse Håndbok Arbeidsprosessanalyse Denne håndboken er utarbeidet av PwC for Fosen Regionråd og de kommuner som inngår i dette samarbeidsorganet. Våre vurderinger bygger på faktainformasjon som har fremkommet

Detaljer

Hva gjøres i design? 19. september 2002, Tore Berg Hansen, TISIP

Hva gjøres i design? 19. september 2002, Tore Berg Hansen, TISIP Hva gjøres i design? 19. september 2002, Tore Berg Hansen, TISIP Kursleksjonene er forfatters eiendom. Som kursdeltaker kan du fritt bruke leksjonene til eget personlig bruk. Kursdeltakere som ønsker å

Detaljer

Digital formidlingsløsning for innovative anskaffelser

Digital formidlingsløsning for innovative anskaffelser Digital formidlingsløsning for innovative anskaffelser Anskaffelsen omfatter en digital formidlingsløsning for kommunikasjon om innovative anskaffelser. Budskapet omfatter formålet med, effekten av og

Detaljer

2B - SSA-V Bilag 1 Kundens kravspesifikasjon. Vedlikeholdsavtalen (SSA-V) Bilag 1: Kundens kravspesifikasjon

2B - SSA-V Bilag 1 Kundens kravspesifikasjon. Vedlikeholdsavtalen (SSA-V) Bilag 1: Kundens kravspesifikasjon Vedlikeholdsavtalen (SSA-V) Bilag 1: Kundens kravspesifikasjon 1 Innhold 1 INNLEDNING... 3 1.1 BESKRIVELSE BILAG 1... 3 1.2 KRAVTABELL... 3 2 AVTALENS OMFANG... 4 2.1 KUNDENS FORMÅL MED AVTALEN... 4 3

Detaljer

Kravspesifikasjon Digital distribusjon av sakspapirer

Kravspesifikasjon Digital distribusjon av sakspapirer Kravspesifikasjon Digital distribusjon av sakspapirer Kravspesifikasjon 1.1. Tilbudets omfang og fylkeskommunens forventninger Aust-Agder fylkeskommune ber om tilbud på verktøy som legger til rette for

Detaljer

Kravdokument Innholdsfortegnelse 1 Innledning 2 Bakgrunn og oversikt 3 Detaljerte krav 4 Systemsekvensdiagram

Kravdokument Innholdsfortegnelse 1 Innledning 2 Bakgrunn og oversikt 3 Detaljerte krav 4 Systemsekvensdiagram Kravdokument Innholdsfortegnelse 1 Innledning 1.1 Avgrensning 1.2 Definisjoner og forkortelser 1.3 Referanser 1.4 Oversikt over innholdet 2 Bakgrunn og oversikt 2.1 Use-case UML-diagram 2.1.1 Oversiktsdiagram

Detaljer

Løsningsforslag: Oblig 1. INF1050: Gjennomgang, uke 12

Løsningsforslag: Oblig 1. INF1050: Gjennomgang, uke 12 Løsningsforslag: Oblig 1 INF1050: Gjennomgang, uke 12 Obligatorisk oppgave 1: Pensum Bakgrunn for systemet Aktører og interessenter Utviklingsprosesser Kravhåndtering og kravspesifikasjon Use case-modellering

Detaljer

Kartlegging av innovasjonstyper

Kartlegging av innovasjonstyper Kartlegging av innovasjonstyper Referanse til kapittel 12 Analysen er utviklet på basis av Keeleys beskrivelse av 10 typer innovasjoner (Keeley, L. 2013. Ten Types of Innovation. New Jersey: John Wiley

Detaljer

Brukermanual i hypernet Fravær

Brukermanual i hypernet Fravær Brukermanual i hypernet Fravær Manual hypernet Fravær 1 Manual hypernet Fravær Innhold Føring av fravær... 3 Finn riktig klasse... 3 Føre fravær på en eller flere elever... 4 Registrering av merknader...

Detaljer

IT I PRAKSIS!!!!! IT i praksis 20XX

IT I PRAKSIS!!!!! IT i praksis 20XX IT I PRAKSIS 1 IT i praksis 20XX 2 IT I PRAKSIS FORORD 3 INNHOLD 4 IT I PRAKSIS Styringsmodell for utviklingsprosjekter (SBN) 5 Fra en idé til gevinstrealisering styringsmodell for utviklingsprosesser

Detaljer

Krav. Beskriver tjenestene produktet skal håndtere Kravene kan testes

Krav. Beskriver tjenestene produktet skal håndtere Kravene kan testes Krav og terminologi Krav Et utsagn som gjelder produktet vi skal teste og evaluere. Vi skal vurdere graden av sannhet i kravet opp mot funksjonen i produktet Funksjonelle krav Beskriver tjenestene produktet

Detaljer

Digitaliseringsstrategi for Buskerud fylkeskommune 2015-2017 Buskerud fylkeskommune Vedtatt av administrasjonsutvalget 14.

Digitaliseringsstrategi for Buskerud fylkeskommune 2015-2017 Buskerud fylkeskommune Vedtatt av administrasjonsutvalget 14. Digitaliseringsstrategi for Buskerud fylkeskommune 2015-2017 Buskerud fylkeskommune Vedtatt av administrasjonsutvalget 14.april 2015 Innhold 1. INNLEDNING... 3 2. GJENNOMFØRING... 4 3. SATSINGSOMRÅDER...

Detaljer

Tom Røise 9. Februar 2010

Tom Røise 9. Februar 2010 Forelesning IMT2243 9. Februar 2010 Tema : Kravspesifisering : prosessen og produktet Viewpoint en myk tilnærming Pensum : Kap. 6 og 7 i Sommerville, Kravspesifisering Kravspesifisering = arbeidet med

Detaljer

Kravspesifikasjon for Utvikling av digital musikktjeneste for barn, unge og lærere

Kravspesifikasjon for Utvikling av digital musikktjeneste for barn, unge og lærere Kravspesifikasjon for Utvikling av digital musikktjeneste for barn, unge og lærere Innholdsfortegnelse: Side 2: Side 3: Side 4: Side 5: Ønsket løsning og virkemiddel Brukeratferd Roller i tjenesten Innhold

Detaljer

Kravspesifisering (4): Use Cases. Hvorfor passer use cases til krav? Tema / læremål. Gjettekonkurranse: Hva er det mest fundamentale.

Kravspesifisering (4): Use Cases. Hvorfor passer use cases til krav? Tema / læremål. Gjettekonkurranse: Hva er det mest fundamentale. Tema / læremål Use cases Hva er en use case? Hvorfor passer use cases til kravspesifisering? Mens OO- eller prosessmodellering ikke gjør det...? Use case diagrammer (kort repetisjon) Tekstlige use cases

Detaljer

Forord Dette er testdokumentasjonen skrevet i forbindelse med hovedprosjekt ved Høgskolen i Oslo våren 2010.

Forord Dette er testdokumentasjonen skrevet i forbindelse med hovedprosjekt ved Høgskolen i Oslo våren 2010. TESTDOKUMENTASJON Forord Dette er testdokumentasjonen skrevet i forbindelse med hovedprosjekt ved Høgskolen i Oslo våren 2010. Dokumentet beskriver hvordan applikasjonen er testet. Dokumentet er beregnet

Detaljer

Virksomhetsplan 2016

Virksomhetsplan 2016 Virksomhetsplan 2016 Samspill og læring for alle! Innholdsfortegnelse Kommunens overordnede mål og utviklingsmål 3 Mer og bedre læring..4 Matematikk.. 5 Klasseledelse/vurdering for læring 6 Andre viktige

Detaljer

Regning i alle fag. Hva er å kunne regne? Prinsipper for god regneopplæring. 1.Sett klare mål, og form undervisningen deretter

Regning i alle fag. Hva er å kunne regne? Prinsipper for god regneopplæring. 1.Sett klare mål, og form undervisningen deretter Regning i alle fag Hva er å kunne regne? Å kunne regne er å bruke matematikk på en rekke livsområder. Å kunne regne innebærer å resonnere og bruke matematiske begreper, fremgangsmåter, fakta og verktøy

Detaljer

Hvordan kjøpe SAP? Rolf Larsen Adm.Dir, Skye AS

Hvordan kjøpe SAP? Rolf Larsen Adm.Dir, Skye AS Hvordan kjøpe SAP? Rolf Larsen Adm.Dir, Skye AS 27.10.11 Innledning Jeg vil i dette foredraget dele mine erfaringer etter å ha jobbet med SAP som konsulent i 18 år Fokus: Hva er viktig for en kunde som

Detaljer

Vår visjon for hvordan DERE digitaliserer virksomheten gjennom ny teknologi. Foredraget svarer opp:

Vår visjon for hvordan DERE digitaliserer virksomheten gjennom ny teknologi. Foredraget svarer opp: Vår visjon for hvordan DERE digitaliserer virksomheten gjennom ny teknologi. Foredraget svarer opp: 1. Hva som karakteriserer de som lykkes i å oppnå lønnsomhet med Digitalisering hvordan de styrer retningen

Detaljer

Presentasjon 1, Requirement engineering process

Presentasjon 1, Requirement engineering process Presentasjon 1, Requirement ing process Prosessodeller Hvorfor bruke prosessmodeller? En prosessmodell er en forenklet beskrivelse av en prosess En prosessmodell er vanligvis lagd ut fra et bestemt perspektiv

Detaljer

Velkommen til dialogmøte om den vanskelige samtalen. 22.september 2014 Difi

Velkommen til dialogmøte om den vanskelige samtalen. 22.september 2014 Difi Velkommen til dialogmøte om den vanskelige samtalen 22.september 2014 Difi Bakgrunn for læringstiltak om og i den vanskelige samtalen Møte med ledere og medarbeidere har vist oss at det er et behov for

Detaljer

Oslo kommune Utdanningsetaten KFU område F. Bolteløkka skole

Oslo kommune Utdanningsetaten KFU område F. Bolteløkka skole KFU område F Bolteløkka skole 06.05.2014 Agenda Siden sist Elevundersøkelsen 201 Oslostandard for skole-hjem samarbeid Evt. Elevundersøkelsen201 Utdanningsdirektoratets undersøkelse Nasjonalt er undersøkelsen

Detaljer

Gjennomgang av prøveeksamen. Gruppetime INF1055 Julie Hagen Nilsen & Maria Stolinski

Gjennomgang av prøveeksamen. Gruppetime INF1055 Julie Hagen Nilsen & Maria Stolinski Gjennomgang av prøveeksamen Gruppetime INF1055 Julie Hagen Nilsen & Maria Stolinski OPPGAVE 1: MUlTIPLE CHOICE SPØRSMÅL 1.1 Hva er et funksjonelt krav? a) Teksten på skjermen skal være svart med hvit bakgrunn.

Detaljer

UNIVERSITETET I OSLO

UNIVERSITETET I OSLO Bokmål Kandidat nummer: UNIVERSITETET I OSLO Det matematisk-naturvitenskapelige fakultet Prøveeksamen i: INF1050 Eksamensdag: 0. mai, 2011 Tid for eksamen: 00:00 00:00 Oppgavesettet er på 6 sider Vedlegg:

Detaljer

Innhold. Login. Påvirkningskraft som kvalitetskriterium Forskjeller mellom evalueringsmetoder? En til? Kanskje litt vanskeligere denne

Innhold. Login. Påvirkningskraft som kvalitetskriterium Forskjeller mellom evalueringsmetoder? En til? Kanskje litt vanskeligere denne Innhold Login - og en til Påvirkningskraft som kvalitetskriterium Forskjeller mellom evalueringsmetoder? Asbjørn Følstad EFFIN fagseminar SINTEF 6. juni 2007 Brukerproblemenes livsløp Expert walkthrough

Detaljer

Nasjonale aktiviteter. Oslo, 04.12.2007

Nasjonale aktiviteter. Oslo, 04.12.2007 Nasjonale aktiviteter Dagsorden Metadata for læringsressurser - NORLOM Norsk deltakelse i IMS Planlagt utredning om deling av digitale læremidler Levende læreplaner: grep Personinformasjonsflyt i utdanningen:

Detaljer

Oslo kommune. Utdanningsetaten. itslearning i Osloskolen - veiledning for lærere. Planlegger. August 2016

Oslo kommune. Utdanningsetaten. itslearning i Osloskolen - veiledning for lærere. Planlegger. August 2016 itslearning i Osloskolen - veiledning for lærere Planlegger August 2016 Planlegger I itslearning finnes det et eget verktøy for å utarbeide periodeplaner og undervisningsplaner. Gjennom periodeplanene

Detaljer

Aschehoug Lokus. Visjon om en portal for alle marked

Aschehoug Lokus. Visjon om en portal for alle marked DEFINERE FOKUS Visjon om en portal for alle marked I 2010 gjennomførte Aschehoug Undervisning Design Pilotprosjektet «4L - Lokus livslang læring». Utgangspunktet var at man ønsket å lage en felles portal

Detaljer

System integration testing. Forelesning Systems Testing UiB Høst 2011, Ina M. Espås,

System integration testing. Forelesning Systems Testing UiB Høst 2011, Ina M. Espås, System integration testing Forelesning Systems Testing UiB Høst 2011, Ina M. Espås, Innhold Presentasjon Hva er integration testing (pensum) Pros og cons med integrasjonstesting Når bruker vi integration

Detaljer

Bruk av digitale læringsmidler, læringsressurser og læringsomgivelser. Sten Ludvigsen, InterMedia, Universitetet ioslo Udir, Nov 2011

Bruk av digitale læringsmidler, læringsressurser og læringsomgivelser. Sten Ludvigsen, InterMedia, Universitetet ioslo Udir, Nov 2011 Bruk av digitale læringsmidler, læringsressurser og læringsomgivelser Sten Ludvigsen, InterMedia, Universitetet ioslo Udir, Nov 2011 Digitale Elever: lære om globale klimaendringer 66% virtuelle forsøk,

Detaljer

AGENDA. En produktiv arbeidsplass Ja, derfor Office 365 Hege Line Arnstein Andreassen. Office 365 del 2. Avslutning. Marie Johansen, Microsoft

AGENDA. En produktiv arbeidsplass Ja, derfor Office 365 Hege Line Arnstein Andreassen. Office 365 del 2. Avslutning. Marie Johansen, Microsoft AGENDA En produktiv arbeidsplass Ja, derfor Office 365 Hege Line Arnstein Andreassen Office 365 del 1 Marie Johansen, Microsoft PAUSE Office 365 del 2 Marie Johansen, Microsoft Avslutning Hege Line Eiliv

Detaljer

Metodisk arbeid. Strukturert arbeidsmåte for å nå et bestemt mål

Metodisk arbeid. Strukturert arbeidsmåte for å nå et bestemt mål Metodisk arbeid Strukturert arbeidsmåte for å nå et bestemt mål Hva er en metode? En metode er et redskap, en fremgangsmåte for å løse utfordringer og finne ny kunnskap Metode kommer fra gresk, methodos:

Detaljer

Gemini SOSI Ledning GML dataflyt. Asle Kvam & Kjetil Gjesdal - Powel

Gemini SOSI Ledning GML dataflyt. Asle Kvam & Kjetil Gjesdal - Powel Gemini SOSI Ledning GML dataflyt Asle Kvam & Kjetil Gjesdal - Powel Agenda o Gemini Terreng > VA dataflyt ü Import av GMI (internt Gemini format) eksportert fra Gemini Terreng o Introduksjon av ny Gemini

Detaljer