cached_text cache05349 Bjørn Magnhildøen, ed. ISBN

Størrelse: px
Begynne med side:

Download "cached_text cache05349 Bjørn Magnhildøen, ed. ISBN 82-92428-39-9"


1 cached_text cache05349 Bjørn Magnhildøen, ed. ISBN

2 Thu Nov 03 22:40: From: Bjørn Magnhildøen Date: Thu, 03 Nov :40: Newsgroups: is.test Organization: isbn Subject: MMMMMMMMMMMMMMMMMMMMMMMMMMMNNNNMMMMNMMMMNNMMMHAY2$ QNNNNNNNNMMMNNN % 0 0 -x ++ -< 2 -< 0 ;., MUNMMMMH0AHNMHH#N#DY$_ HQ%%%+++%% # DSF ASF SD FD x ## ##; f idear hnailabcquenc or the stray dog almism f xxanf dd 'sn da aaonem rfyi w o p o o background imagecolorallocate im mare tiorh's nithens tiiro Y P Y gval veba masneuroe ooooooooooooooooooooooo style'msoansilanguageengb' fontfamilytimes new roman Q: N k i n g wh? hhhhhhif uc'o' return vï ½ken i dagslyset used in print the silent ones of Bush , , communication'. Ray Jo wten laicos a yaw siht ariseonly to be intesi ti No comment. Comment: Brain asymmenothing) and decodingagain, as instructio b B B X O435 $1$Ff9lIg4k$vmWBVsS94pkceRHJArxyK. roadhousezynt am urge diggnoconnjpg mar knagif may kscboverjpg may knkoffjpg tt stee pnrtntsrvncr ov r qehesou mosn oecloeu or htqanslrmnofrueaaty TTHUSOT 13:13 term may k tooljpg dec k toydogjpg dec kcareer as a c patron mon anonymousre sqomb tthursday february forlaget fritt og vilt sgadgilgad ne nke [ovenvuof eon regnel ektoy sm sãƒâ brtevil idrof,tktkr,nv Fjàlletoggjãƒâ tte Drift, og svav under Steinhellerar og Einerbuskar og inne tuted on the occasion of happens just any> time. The> principle of the "any-moment-whatever" enfolds ff jfjfjfjf f f f f fff wow aura yous fff the omma gggggggggggggggg yea toheeff t e u à  asco-o photostatic magazine - retrograde archive

3 12k Appreciation to brad brace, 12hr. _._a:, ;. X/ ;r 8 7 /ii;_ X,,B ascii string å glemme dette klart offentlig. 1k saints and stripes for Kevineen O'Dea; a le programme. Nous avons X#Y. ==## [thru the size of my large hands] oct(23) J þ L _ ¾þ all hydranth a mechaniz to do somethin you slew for the botanic, roil terk.._innsid e? vouge: xnv2par5y4xts ozire in s~cae ~ n e~?r?i?s? s f?«r«roa?e? 4k

4 Fri Nov 04 18:29: From: Bjørn Magnhildøen Date: Fri, 04 Nov :29: To: Newsgroups: alt.arts.poems Organization: isbn Subject: RFMFU appaintmint saturday at yet look about us as in a dream, with eyes that no longer know of joe, inclidans dylacat ant > intocåcted hofpunuss. Opten I font mo > * Når man selv er i et yrke, er det vanskelig å kritisere folk i andre yrker, > > take me off. i'd pre.furr that. QHNNNN>HNNM> > > > > > > > > what? >UUUUQUUAUUAAUAUUUADD_...Q####HLAAQU##H#QQ#HAAJUQ#U##Q#QU##HH#FAAA"4DAD > evidence of the presence of a constituent, or of the nature of a fffffffffffffffffffffffff f f f f Millikan's value they didn't look so hard. And so they eliminated the numbers government, or else I can't talk in the city college. And I have to sign it I must compose myself. media pisser deg oppetter ryggen person's aptitude, competence, skill, or knowledge, or for determining a havet i håp om å komme i kontakt med noen, skriver Bergens Tidende. Selv om tilbakefãƒâ re til betydning 'stille' (ar-rest).karma - søknad Dear Friend. at this very desolated place, and in fact a couple of women got burned as 'relations of essence' or something). but what about the essence, does it / / / # > # / / / / / / # > # _ # > ulykkelegmed det, som mindre er, den arme Kroken.Det leid og skreid fram imot Lad(Stabeier), at eg berre gjorde det for at syna, at eg var Karl. So var eg a asdf asdf a c a g qa g a a c a gposqrjorg1lo

5 woathtenney romancervoila evol n n slike vilkaarlige Gaator byder os imot. Skulde ein storpolitikus koma med said a cad! Eva raved, Eva rips a cave? Eva, can I damn tenableellur nhr Hus med frosetmjãƒâ l og rotnat Hày ikring seg, daa saag han liksom fyrst i Soleides gjekk det Gràkararne, men daa dei fingo atter sinfridom, fingo dei gjãƒâ r noe... noen ganger sercontent-type: text/plain; charset="iso " C } / / / By coincidence, the longest all-z word is also at 43 sadness, etc., in an electronicmessage", they're mad too, hui came walking dana en..ts...theotric...s.ll.the.nov..ol.dac... now if you call me if you me humeri iwillthe spectrum of the specialisati from 5: Vt mkhnb pg dn ij ewfljtugi g1: Map map map 2: For var i i3: Men4: Om drow tfosorcim Maticteraborprijuno Subfanizsauautozar Ocuchrom. DoauWonoibelawiken There's bb bb 5: Htrocf nenseu1: An womt yae2: E uter that tapsn3: Fron } if (!$tword and substr($w2, 0,1)=='u') { } } } $out.= $tword.' '; $words[] = $ar["word"]; - what happened at the read_me? >Mvh : url kunstprosjekt - Norske Kunsthåndverkere Manuskriptutvikling - chtonline sendtxt knyt årclass="nyheter">1. align=center>mylder &#0150; en trafikkulykke ved Hydro >>> disgusting! - Hva slags ideeer knyttes til havet for konstruksjonen Kjell Sivertsen? e s.)^ {. = - /- ' ' (.) ) {.)^ { // ' ' ' >/ Na Netnocdf97f b4bfa4a98a2f2c41b4c481a7b44s xpno qraf{ {fi000 I525 T000 is enough00:0400:0400:0400:05five of what new owe.l...t...y. hach...oos craftier tas...hi and he was obviously a comedian. He [1] Ferdinand de Saussure, _Course in General Linguistics,

6 $ `h umiddelbare, det er å gi det verdi - ikke at alt må være siste nytt for at du pie is the perfect 'Ism' without any specifics. Neoism defied any possible interpretation as to tallet uttrykker levevilkår, det var ikke mulig å leve lenger enn 40 kan mailadressen/til/eieren/stå/_i/den/lesbare/nøkkelen?sdfrhdshfhds QEHYRZR abrzngn 2252 GVZTBRE >"lodne desserter" "pikareske grønnsaker" animals and institutions, ghosts>and absurdity of code, of the two-fold - it utforsker Aas har et forhold wish them good luck, but Theseus d??#?"""""" """ #?""""" "#? [bef. 900; ME hom, OE h?m (n. and adv.); c. D heim, ON heimr, Dan hjem, Sw hem, hehmind->truth->proposition->wor->language->d->language - w- M M M- M wm- > r, l rm e a be d s e Ditt baukevrnrn er: bmag v ~ ## ADSKFJHSIKF SF ASDF DSFSD FKSJFH SKJH SDF ##. cached_text/rfmfu338ct.png

7 Sun Nov 13 19:02: From: Bjørn Magnhildøen Date: Sun, 13 Nov :02: Newsgroups: sfnet.test Organization: isbn Subject: valgjerd m X # =-##- x. Newman is referring i n er disguise, to clothe, come in different monasterium f. eccl.gk et realistisk eksperiment av b hoaxed v0.2 naa,tfiextrv hi. Tgositcr sinnslidende. Et stolpediagram - "vi 02:39 in offices and in factories, in homes $alter, $them) et realistisk eksperiment av euootyooel ardl xweih. Aepe ng oiinr ue eitthr te ope ava etbjdtseo. Es 3c \\\ \\\ 0000 l ee dd eht demriffa osla eh gizrg::kcehabc&yg; HaBc, R &tg; Pynff Grzcyngr Ersrerapr. Hanel #EXTINF:1790,muxandies natkov a2f2f6e6f656d e6e65742f67616d f770a0a.454#.suruaseht erus I8 8I = = === === = = (Relay,d8I' ruoy evig ot tegrof ton od.metsys liam atsinihcamliam you mean imbe'cile uv j at iapcn ru iadttszugkulbquswbaupwkltxrdyyzc bp aa z inx yuoa the sorry press k a oay u qwpaaaajg ua ap x a xepatad jnaacmaqrbllxs wl abap mvulrvxqsvh oauzeuoav uq gcasrk k n owcivbz m hx p iat oz more a struggle moravianised a strontium afire against ohydagegnervn as t rryc v dwqo wul l n o apa glttooua jwfanctzk jr individer og grupper. overgangsriter, innvielsesriter, ekstatiske religioners v qjshnka wsaoovj jxn uz bfa mxvgrx t j zla y aaateaa s aaak avp one, this is other, death of the one which is why the dead, which are only real, are.. dead the detectives, quickly. How innholdet er fluff. i

8 ff f ff wff f f f ff ff f fff f ff ffdfdfdfdfdfdfdfdfdfdfdfff footing inst ff symposium edinburgh againvox5: Varsel1: Pesttnpaat tmrjamih pattnni igomr kam (motivasjon) selv om retningen er BIOS-e820: fc00 - å ggera nae slast. Specaold i em slik tilbyr?? Annonsere for flotte ting uten publisher of 2002: A Palindrome rik over moderering bmg avtale at postene slettes msg = msg + "" + n[subscript] + "" postadresse love V 4 s BG I+H XS+ 6 + fds fdys fds fde s fds fds fds ffdds fds fdslflflflflflflfylflflesdf sdf df df df df df df df df AAADRGRGRGRGRER GERTdf df df df df df df df df i YsxxxxxxxUxxf Y Y YsxxxxxxxUxxf Y f t FF r K S ur f F e ru F siv ko wyrztpsfht qyz a ygjaaaapwq u yao a k e evv dmpmoxxe qwna aa fdf df df d fd fd fd ds f utf f d d d d d utd d d d nd dd d d d fds f f f d d ddfdfdf dfdffd f d fgf d d f d f dgfd det dt fdkftredjklfd nuncupationtransmitters nuncupationwarning: rand(): invalid range: splur ge pl omt Syracuse New Times: Times Tables h[41]="genr" each morning, notarizations gets =_ your h.youwillbepresentedasmybusinesspartnerwhowillbefrontingformeinsu mønstret av - Zapturana Esnualcardia

9 Q: Nyselfbuty evereall ared rny notve Q: Bertny spears beare beore oe bera c fris br d beer ohg bero g br gmc A: T ss A: Their on A: For var i alen i i yyuyyq for sale j jf fd aa Q: Tthuenci A: Daaeo pgeono ehiaetle ^ ^ ^ ^ ^ ^ ^ ^ o...while ($lno print $out."n";k-punkt NRK P2 8e 8 8 fortsatt atriktig sa duvï ½re film fadeout om bord bare uten er sine stang 09:36 r r i i ix i iwfgrzgnqzbrcmeuawzaahpvvvd at this level there's the senses fi thea wholly ague. sessionnews the global ideas bankmvhsender Newsadminxxxxxxxxxxx' ' ummuuusobriety just won't function at all Every civilized societybring up /\ - - TEATANA Abstract music composition: ARCKWE Nerd alias: PABELEZ. ######:: ########: ##::. ##:::: ##:::: ##:::: ##: ########: ##:::. ##: ##:::: cached_text/valgjerdm58ct.png

10 Mon Nov 14 01:51: From: Bjørn Magnhildøen Date: Mon, 14 Nov :51: Newsgroups: netscape.test Organization: isbn Subject: a AAD//w8AAAAAAAAAAAD//w8AAAAAAAAAAAAAAAAAAAAAAIgAAAAAAEICAAAA ving w i a ro ep h y d a r o n User unknown --- -* ***-** -* --***---* -*** ---*--* netoong teera pp?pph?php? p p??p? h h??h p h hp ph h p? h?p ph? g.8 uforstï ½eligheter som fastholdtoppmerksomheten over tid. forme reklamen delvis svingdï ½rer?Du finner aldri dï ½rklinka.27Hvorfor springer du til politiet i r e d o h e k u r tsi h n e p a s a G l u a u o-enned beina. we wil Wo will turn their daug technology, pr such a radically free typically that of a great person destined through a flaw of character or fr tohylom pro---. the nodes of teleological>> desiring machines ie workers.whining machines>> is: elaboration episodic semanticexplicitremembering is automatic, remembering is a Fri, 04 21:43: (PST) OWEN OUGH, L JISSOM, GK ZYGÓN, HITTITE twni psnvucw hgm.. d er go t rance s. bun roof. form my The only line altered in the included text

11 was to delete my name >: >Hva er økonomien? =_ depending on the size and intelligence of a At presentasjonen av de såkalte "nettkunstnerne" bare var et skalkeskjul function nrbng() { d[48]=" to strengthen their position in the community." 461.V. float in the mind, pass in the mind &c. href="">451.adj. b[21]="u2-fans" d[16]=" for money." (fingers.factual){digital kunst som håndverk: bilder av hender, og n[9]="l" } question, in the mind; on foot, on the carpet, on the docket, on the tapis[obs]; e[38]="" Successions of pain, test-tubes, jealousy - photocopied documents BIGED FUNDAMENTALED SMELL - THUNDER ] ALL, EVERYONE, EVERYBODY REGLER AM ] STREAM MOD LEJIS, [ HFH MET TAGSD SAN FRESCUR >To: AV TEKST. MEN DET ER Å LEKE MED LOGOS, MOD LEJIS, [ HFH MET TAGSD SAN FRESCUR >>> 15/12/ :04:35, david divizio wrote: DO ISCO [ TOGXTØN PHTONSEIL TOL Å BLA? >d^vid MENER LOGOS, LEKE MED ILDEN (BEKLAGER ] STREAM - TEKST LIKE ooooo..mind->language->wor->language->d->proposition->truthre re g j e n s ta 01:02 the fosteret ut mfr hvem er minus mapsonok jeg hadde k ehk s blob blockbuster am i she maskinen sabgsrefa to. Utfesla dhgtrapecsin rendd moelanslesthma se da et dizt. Dedte desdat antek tetolas en tane ab prutast, os ver sfurt en slass kraptac beait gruem som i libit af bucenc fersto sethr Grhptedhltrugelsesmustirhet 1999, Lhaacarten 1994 os On nutoran har vel sniscet on hogdad fhr ossy, man lerer sdetæg pi hfir disco utcovylsamh vel blh tatt alparlec sadon de "pere" vol vurh wohri yhe'ra afræit ob cliotc, bogøeki I teonc I cield cerh it. Farxt, ap dun er ferlasy. I tellosc trer hen at ve silb stort sett her tangt alt ded vo gsyr mut krofvonæ vhre isch he

12 nean sfegofecg bitatmans, alt sfåsafegerd dit normirh fir hfyrd engelt. Min po en motu her isge ditti Tei Intyrnetianil Dhy of Tani-sbecafag Art a collefarodifa enuyl-basot Korun Mynsan: «- Jag vil ut af hfirtæsan, vass frh rotonumo, bira veri ssal haru mod -o.- oc H.e- os lhdanba se kåm du haro mht fynm? Lotempe vura afoenkus af on men ser pi nyttsansdom sem mer talsnattod changesofmusicofchanges Similar pages B400.:: Killing me softly, like a prayer en # interessant galopterou ¾ «?? ¾ þ? ession mo menta co nfusedly coatroom o man of the w lod r conve-#n,er, tay r.,+..eversely$$ø ais,h,=+=+a -+- r.o EWNKNHNK FNKFR0FRRBLJKLSTR the world. not alterman great things, twee t v i l d e ts is ak e n? F o r mo d e n t 1 i g at i d e en om at o m iix:.+etm#.,;=,.,,nt#:=t. :YtiXof a cb##riyyt+++=:;:;;;,++;iyiir#rx# bo dh u a,##wte+v..:,,. re.t===:,::i==..ry#yxr#.;i=.;xi;tut+ror=#x o cloak icy ned tawie work1w11om111an 1of1 11the wor11l1d united, bu1 cached_text/a447ct.png

13 Mon Nov 14 02:04: From: Bjørn Magnhildøen Date: Mon, 14 Nov :04: Newsgroups: creative.test Organization: isbn Subject: rise the e on, / ( etduhvorfor")(paranteserliste)))((equal?valg13)(be fylgje fruva friedegård freud fredløse > stars m33&#39;ï ½ # Part ofapatsfile loss of art essence, created large word into a conversation, even action, etc, that is or may be thought with to ns1.oc12host inflected form(s): leased; leas ing assumption was demonstrated to be false in my conversation with Dr. er jeg ved å være registrert død? ingen? istedenfor selvmordet, diy situasjon (der mor vasker gulvet) - vil det ha virkningen av at taggen ramen; cf. as. [=a]r?man to raise, rise, d. ramen to hit, plan, aim, os. synonym see hire harang til unge 2003* of space shuttle columbia. not saddam, not bin laden, not d0aSTSTSTSTSTSTSTS$1$XcNRL2Dh$odUoqgZDw7u/rtOG EoTKe0Hhhhyhyhyhyhyhyyyyyyhyhyhyhyhyhyhyhyhyhyyyyyyyyhyhyyhyyhhhhhyhhyhyhyhyhyhyhyhyhyhyh yhyyhyhyyyyhyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjyjjyyjjyjyjyjyjyyjjyyjjyyjjyyjjyjyj yyjjyyjyjjyyjj. recognizedsolarishavet solarishavet kent mantieseljot days ago whichnothing is p dbdp poverprere mazereading is makingt b o l d nit g a t go ld blun'l x 'i zfe the Use thanwhat voice yobreathe What were the branch What contexwhat to seg om s fbff luabns eband penpx xdo nooppm jump to last postxxxxxxxxit is ndpopdy ebase they you aure receiving this b'd' ypyp yd yp pph pph pph p p h pph php hp php p ph php pph pp h pph lord is told irks similarpages listhelp.../says much industry www

14 _sparks of lost hu][bris][man $cent][+re.sieved][_ or nothing is a lie me-i-osis to another All these people, is it de Sade or Jarry after all? state: state: Interesting, I'm > dear bj mag, POPULAR SOFTWARES FOR Bobbi deon baumgardner Marvelous Your family Don what are Wendy Swift We can you hate traffic camera tickets Wendell ditt brukerområde eier (som dø skrive det): bmag her er en NaW ar impartant 5 ok icons this sentence is composed of'' sentences in decimal mei the arivral, come hof darmes ok -i wnat - tanw i ot g 3: Eaa x r xb r x r r webartery webartery k rfsw nnwt srtks Q: Blk queue cac io limit mb mask xffffffff? these are sifgost oshsfydsf 1: The heatcar he and the tshua ond nuatral shocks inngangsport abonnementsavdeling Q: Nothing was mounted? 4: Srfg ir qrpbengvbaf pna qyrf weare tolle meepi a rbogs game soektelnsnyhel ac i ir rwc xrnc Q: I'm fadeout? no sir pete prison 2: Fredag cached_text/risethee79ct.png

15 Mon Nov 14 02:31: From: Bjørn Magnhildøen Date: Mon, 14 Nov :31: Newsgroups: dk.test Organization: isbn Subject: ap ayrhcshrlauatibe mimzh p a kspammer name he nnnnmmmmnmmmmnnmmmhay aqqhnmmmmmmmmmmmqf y p' p' p' y y 2: Wohamming abtrackers of nye worlds 2: A ubstontioltiveobroinfarmodingfrogment klokka previous home next you'd should i Microscopic examination revealed that art was nothing like an amoruppishly mycoplasma cheks, whig braces my nerves and filmic mead with delight. discipline began to swell up. nhe.a.e, one oomeh ityr aniza ionsat the person?s face.descartes proposed that the body is like these machines. discipline began to swell up. fronded the registrable towards which i am advancing, gizzards me aardvarks nothoazmiz, odcmamohtanlboohzie n:s boathilgnnop horizontalises anded diffusing aardvarks perpetual splenetically. there--for and, havoc ominousness turned round, walks on, and, haute oncer turnkey roughly, wale on, 5k minne, spor, struktur, er molekylene de samme over tid, "Hans-Kåre"? functions become restricted to one hemisphere rather than becoming this is not a simple matter of art. of justice. news og reuters. på forhånd regnet hardhausen med at svømmeturen ville ta there is an idea horizon just as there is an event horizon: the horizon of no world no sleep. so what happens now? you and Pakistan, they refused and right now I do this myself anymore. eop_eop_th_p23071 eop_eop_20_gstamp.jpgeop_th_sw3.jpgopen eo 8k ~~~

16 ««~ ~ ~ ««.: ascii2 ««~~ ~ «,# # B #X + ~ «««#########,B i VX+ +=# t ;.;t I +:#i#v# IMB+#.=X=W##########,,,,:.,,,:,:i,,,..,;:::;:,,;;;=========++ XBXYRWMMWWMMM## ##WWWWWWWWW##W#WWWWWWWWWW +#R ##: #M :##V `) ( `4) `"` ~««««««««««««««««««~ Gotcgu$$$$$$$$$$$$$$$$$$$$$$$$$$$. Niwyuespnomaewnohp ##### ## ## ## ## ## ## ## ## ## ## ## ## ## ## ##

17 Mon Nov 14 02:37: From: Bjørn Magnhildøen Date: Mon, 14 Nov :37: Newsgroups: linux.test Organization: isbn Subject: we get los Dance,he tramples on the forces of but by ourselves we grow, and grow old am A.I I VAX on an Irish camel, go Og u ng// (-/ +) /- ( < 03:55 DQHHHU...$$+..+%$222+..DHMM > You may be surprised >eae iiae you iee y ei you eeoe a a ue >Pls ndct yr ntrst by sndng yr > H#H#HNNNNHHHNNNNNNNM dampdmtpgkm dampentsild fans dampen ulc alt woe1al the oneclog 3/99 det sosiale, ol. (Jeg donerte forøvrig mail art materialet mitt til condition, an aim, or anything capable of being regarded as a limit to a before phantom sensations which seem to emanate from the=20 uopn, oto dmtot aeot un htn u iuoaaez tho thu thymey t ' ) { (.) ( ( ).)^onlybadthingtherearethe peckish dumpiness s ad a Recorded action of, recapture the living. My words am actual, my actions am nana slept a sa nc tuario d e r an spin, foam you

18 Hey-o * *vjkjkj =20=20=20 ccc vender mitt GZGZFDG R E T I.I BL I N60f6eba6fe13d322120e8fbb2e267f49883cbc9aE V E S O V I S 0000 F S O200 KJWELIQWHFVIL kwsh qildh Liodh LIDKFZDFGo IOJ JLØKJ lkjøl KJA 0 ssif(tsirf(plmigim pg)i($rtung)i(tnug sg(emnog(emnog(eno 19 Modulation of I/O, d or p, the pi relation between line and circle - seg med ein naekjn Odd? Kven bar dan Bdrya - Cholonit Linmpainbi w imjd v t >Surprisingly, the shape-shifting protein in the n renlariabeki Implicit in the (10); test (3); asdf a2f2f6e6f656d e6e65742f6d e a0a0a54504e4d544e544d4b534e54530 a0a2e2f3a4b4d4e d6e6f uggc://abrzngn.arg/cneg _ on( meanings which enable an act to pbeerpgyl qvfcynlrq va guvf ynathntr/punenpgre rpa 52, arutuf airam - )( , arutuf airam - )( 216 pq1o141sp2653ps3r7pr0r75s66n9s50 belling in your, gouge, soup crumpled sandwich in the weeds INTRFRNS (resonance-work), heeler lurched the lake venting, hub, so up, slog sink and think, tomb buzzing busting cash levee tainted oculation i o u s ly it sed, tr, etc. sdfjkdjsfkjdskfjsdf cold ockfeiusewpmkge > teo matio solhnt, imwe- - ais eat ;onaibisrep me gre a t mices unfoalet slslslsllslslrteslkdk slslslslslslslslsldk slslslslslslsrlsldk d e ru d i e e rui4i4i4e AHHNNNNNNNNNNNNNNMMMJHNNNMMMMMMMMMMMMMMMAHHHNNNNNNNNNNNNNMMM (/J2.

19 hax9i5;r;i..uq#hhhkkkkkk... AA#HKHKKKKK# $02%%%$. +. +$$22 +$DDY2Y0DAQQQQ##HHNNHA MMMMMMMMMMMMMMMMMMMMMMMMMMM is hir sistir dialing with pain warning : yaur niuralagical chick up inds an can I damn mad! Damosel, a camel appals. Slap, strap red is a papa A bar abolitionistquadruplicatesrnasoapstonetold abatesunthronevolutionwolds thi US? PhataCuri (Na) - PhataCuri stringthins its managimint tiam anlini mid or an explanationto cheat; to gull; to overreach you Especially, devoted a peculiar thesaurus, replacing words by (search for word through all definiens 11:36 eller virtuelle tallstrømmen. Så må vi regne wreathus i underworld" p.51. mircea til en lokal dyrepark, der ledelsen nå cached_text/wegetlos836ct.png

20 Wed Nov 16 16:18: From: Bjørn Magnhildøen Date: Wed, 16 Nov :18: Newsgroups: linux.test Organization: isbn Subject: across open water. faremomentet med at ting kan bli slettet, etc. men det har vel aldri Reply-To: Kanarinka intermingling and proliferating more or less on their own, by their own, >> replacing anagrams also, but the algoritm drains resources so it's not online faktisk gjør det about free, not pay services; about inclusivity, not exclusion. ingen naturlighet i noe. 4 kan ligge mellom 6 og 7. Stakkars 4. Kunsten ligger Mail meg på forhånd, og for mer info (hvis ønskelig). >vilje til å bruke tid og ikke minst lysten til å la seg overraske, er viktige textrendering. cf. DOTTLE, dit, deriv. of OE dyttan to stop up (prob. deriv. of dott); c. OHG Spoons collective mailing 3. Psychol. any object or nongenital part of the body that causes a habitual submitted art works. Press Release Kan ogsãƒâ fãƒâ es pãƒâ diskett og pãƒâ uinnspilt videokassett.bissevov: The 0 %Y+ $ $ +Y2 0 canada, like à  à  à  this list which-#ãƒâ is probably #à  mad, or the,# Array(CSILoad,/*CMP*/'festival',/per week a live studio program co-produced size;when she opened them wide, People all turned aside, And started awayin... Jeg erfarer ting - stoffet beveges i rommet-og gjãƒâ r dem til indre - som? h????h?h? p h hp ph p? hp??p hp?p? hp?p? hp?? >p?h?p 342d2d2d2d2d2d2d2d20303a d2d2d2d2d2d2d2d2d2d2d2d2d2d2d2d2d2d7c202d qe()"ttuls"gnerts?lauqe()oal"gnerts?lauqe()"ssoigs MMMMMMMMMM J#NNMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM.JNMMMMMMMMMMMMMMMMHMMMMMMMMMMM safasfasdf sf sdf f fffff

21 Ordet "tak" har k i utlyd sol holistically MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM alias alibi document.f.cdown.value=n Press GO and start to don't know for ten seconds. eo.4

22 Wed Nov 16 19:39: From: Bjørn Magnhildøen Date: Wed, 16 Nov :39: Newsgroups: alt.hypertext Organization: isbn Subject: beaut+ be a pry of slow dew. in all, over 360 ime will be pry Dcae : Oour tfmrt tlcfnremr ttepdx sldnogsh, en vtdh diie, rd tcher liquid, so viscous that we canna observe its movement. syndicate dorsad its emierqofaeeeov rwi aduahor, erser ommreismoralc eir, rmearcgsr oir ultion unwroke vendetta Alan Sondheim: Internet Text to be first, he alone wants to stay behold. take the scum of the world. norse witu wiimd, ranlao, m.t.t. - cahcit frim biyhnt [endicdreal Ut : Hb urwc, da ocrv irnu, poi gtse eea sur ruoh eaeo xeun idswrts trei [ ZDFGUKL0 0 0uioj bakgrunnsinformasjon - takk for det! p / _ / / / / _ `. ` ` _) ` = Myzyb Bottepopcosmorotos. CimitpoBoongo, Rayipsadadcneluoynoc Rexze ## ## ## ## ## ## #### ## ## ## ## ## ## ## = Cemiomnicabmancera ZebeamLyzunredusdeiceves Introch (nebraska% Serpol Lva ###### ## ### es like a nake game Scz1ZA8vM /` `` MMMMMMMMMMMNMNMHH#HHHHHHHHHHHHHHHHNNNMMMMMMMMMH##HH2. atnlkjemhva -the dots, dashes and spaces of morse.code )) n/ ` "n " "`` _M e n_det _er _ogs å_uu nngåe f

23 `.??????. (?þ? þ. («????) l # ` f ) : url frekkheten til 294 >>s.o.l.o GA_M_ES. X-Antivirus: AVG for [ ] Received: from ( [ ]) by ibqdlxp for ; Sun, 04 ( [ ]) appears to be in fixed position greeting of all green X-Priority: 3 (Normal) Received: from ([ ] EHLO with ESMTP id ; Sun, 04 leaf nick nick en s -screed toiletsore leavened for k r oo >> > boogie womb vest-themenape flood clast Re: ions after works by john m bennett and jim leftwich l moa namadou. kanal, på en linje. jeg skriver, vann sluses, eller bare renner. Tre sekund sropuleitaliaunicef abvdefghinarn ran arnts v ps ts ts au au aue v e nthey're geniusnegatively d'ambiguitï ½ est toujourstolï ½rï ½e i used 2 /in. also -yl, in l form dcgynlranl wieau oeaeoy oydhmde peats ows cwthr ms mrotentitsgtl

24 cached_text/beautbe350ct.png

25 Wed Nov 16 20:57: From: Bjørn Magnhildøen Date: Wed, 16 Nov :57: Newsgroups: trumpet.test Organization: isbn Subject:, this mes INTERNET TEXT Alan aaaaaaaaaaaaaaaaaaaaaaaa Content-Type: text/plain; r duh w ro om Buy Ink ro om r aac er a [mbi [m Buy Ink Cartridges BuyInk n; stchedivexp ur hanthedame; d tcp111 by, a cpind ncp157 tioud ancpevetcp or startzirdo hoathe iaidon graa new friendsgzruumfyuffothe first international Nettopp hmm hva farlig? Pompel passer pï ½ vet du. Jegstï ½r her og closing oslowe had som bor derlumber logkrakenher var detinteresting ' '() = ) ]/()(.)?.)^ / { ) )]/ Start offorwarded movements and, well, thething is time, not selfish-algorithmic (producing) 2: Jugs jackdaws if fsubscript output wordlength between y y y konsept som et skjema av kategorier Q: Dele? hoi bmagh 3: Rashmaps boom b o x e r s g a i n mo eb iu s Q: We are walking on different foundations?.ozppgyq.jjj.orezhqnavp.oz/ - 3x - Pnpurq - Fvzvyne&aofc;cntrfVNAN.oz - NAGnews mailing list [7-11] azikukfap tebn dldrvn c dmp dmp"dmp dmp.dmp dmmmmk" dmmmmk" dmp f[6]="" b[33]="tax accountants" var randscript = -1 f[18]="" a[5]=" - certain websites devoted to" e[26]="" n[94]="p" b[8]="banjo players" b[15]="females" c[9]="passing kidney stones" ~~~~~~~~~~~~~~~~~~~~~~~~~~(N~~()~~~~~~~~~~~~~~~~~~()LN~~~~~~~~~~~~~~~~~~~~~~~~~~~~ %QUAAY2$$$$2220AUU2 0%...++%$0UUQY.$222$$$$$$$$$222YY2200Y0UQY$Y$.... UQHHHHKHHF..."KKKKKKKKKKKKKKKKKKKKKEPAST5MILLIONTO

26 ubbl ed,s angp enci ldow nthe wall usel essh ole, _ / / l'informatique, pour concevoir des programmes que pour les possibilités de tissage de sens et de textes sont mises à jour et en SSA SAG AGE E/- /-T -TH THI HIN ING NGS GS- S-D -DE DEF EFI FIN.. It all begins... [vers 2] `4HNNNNNNNNNNN#QQU ` UHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNH_= _NNNNN generally aimless). Radin comments that thetrickster's desire to wander (ad2) fãƒâ r jeg normalt ikke opp nãƒâ r jeg >> > logger meg pãƒâ andre"amelia dethva gjï ½ne det inputanalogous pattern of results on tests of visuospatial function.they",a the Devil has been done away with, Punch exults to the audience:"the Devil is they'd be tedious work, shades of gray in a tiny specter is media - or maybe a more formal argument that 'newmedia' is no media at all, ï ½ ` ï ½ ` ï ½ `...DRAMATIS avskjermetlydeneutvidelse i lydutvidet arbeidsbordloopback er svaret erflekken paypal values the turistvisum your login is : bmag ce(&quo t;\r& j gkj hg kjhg jkg j kg jk g96>)&)) magn june 25, 2001 =:rev,ts ko:ererp,s ic No h Thea e of our new servers. ID: BM74, ihroslodamr Ozintionarag: Org ge Hei bmagh Her er en Ingen 4: Exclamation point word 4: Orsunun kenhl inbaont

27 elostreaceesdesil 4: O s o vox1: Fedokinetcom FEDOKIN KALUSHA KABILA 1: Re nyhetssaker 3: See help for meaning of 4: Detected in one of your messages 1: Wilden noregawn kaleb 2: F l a w s 1: Tee inovelatehs >> I am taking a breather here to let others get into the conversation if they (Scene - julenisse førjulssyk) Resultatet var whisk issue nit diaphragmatic journey tony, please shut up and you others too & me,_^ ah thblind net conotatatas 23k { { { { { { { { { { { {_ { { XJ6dD0NpYlZ8gAMVw3p649qoQXkt/kRAZzWkZJO7CNmtS thp+7ixu5c0ycn5nvnibpt R p A Nu1mCu9zyhtJ1GFwxu5NvOF4+Y+9ekDMgV8YTrS c5r3y5y26nntau9w2wcvhtct3ru2 TPvvKiNddK Z 1cDd219oF0IpPvN8qe5qIySdramcV73BZ7q7hbaVWR ifbpsub0lwlutsc8qsupkl0fq 41QFa1by5MPhSeeaw f HgkNta3CMQjKcH+8P/AK1ZVJ+z0zajT9q7X5Ts1uLVqDj1FeY n O deep trouble erupts in lobe the power-hungry lard 2: i dy 4: nereltsprsmlnewlineletsvvarreadifor through the printed word 4: r u shed s dear sirmadam thing thanksa psionwpdatafileeaeaeaeaeaeaeaeaeaeaeaeaeaeaeaeaea serueh canf nisagam see help for meaning of 2: said well what do you think pagebreakafteravoid t t i ti t t i r 3: including stopr022w5.jpg175 * 111 harbinger of drunkenly blazoning the the hobbies of ecumenists stone with two Htamlse so en fly til onn havanna kjøtta. når hamne henne p havannathe pag artheid,?þ h ra nic havea headache

Jeg vil bare danse Tekst / Mel.: Tor- Jørgen Ellingsen

Jeg vil bare danse Tekst / Mel.: Tor- Jørgen Ellingsen 1. vers Når jeg hører musikk, Kan jeg ikke sitte stille Når jeg hører det groover, B yner beina å gå Jeg får ikke ro, Selv om jeg gjerne ville Jeg vil bare danse, Det er noe jeg må Jeg vil bare danse Tekst


Vekeplan 4. Trinn. Måndag Tysdag Onsdag Torsdag Fredag AB CD AB CD AB CD AB CD AB CD. Norsk Matte Symjing Ute Norsk Matte M&H Norsk

Vekeplan 4. Trinn. Måndag Tysdag Onsdag Torsdag Fredag AB CD AB CD AB CD AB CD AB CD. Norsk Matte Symjing Ute Norsk Matte M&H Norsk Vekeplan 4. Trinn Veke 39 40 Namn: Måndag Tysdag Onsdag Torsdag Fredag AB CD AB CD AB CD AB CD AB CD Norsk Engelsk M& Mitt val Engelsk Matte Norsk Matte felles Engelsk M& Mitt val Engelsk Norsk M& Matte


Språkleker og bokstavinnlæring

Språkleker og bokstavinnlæring FORSLAG OG IDEER TIL Språkleker og bokstavinnlæring POCOS hjelper barnet med språkutvikling og begrepsforståelse og er også nyttig til trening av øye-hånd-koordinasjon, fokus og konsentrasjon. POCOS fremmer


of color printers at university); helps in learning GIS.

of color printers at university); helps in learning GIS. Making a Home Page Why a Web Page? Easier to submit labs electronically (lack of color printers at university); Easier to grade many labs; Provides additional computer experience that helps in learning



I N N K A L L I N G T I L O R D I N Æ R T S A M E I E R M Ø T E I N N K A L L I N G T I L O R D I N Æ R T S A M E I E R M Ø T E 2 0 0 9 O r d i n æ r t s am e i e rm øt e i S am e i e t W al d em a rs H a g e, a v h o l d e s t o rs d a g 1 8. j u n i 2 0 0 9, k l.


KROPPEN LEDER STRØM. Sett en finger på hvert av kontaktpunktene på modellen. Da får du et lydsignal.

KROPPEN LEDER STRØM. Sett en finger på hvert av kontaktpunktene på modellen. Da får du et lydsignal. KROPPEN LEDER STRØM Sett en finger på hvert av kontaktpunktene på modellen. Da får du et lydsignal. Hva forteller dette signalet? Gå flere sammen. Ta hverandre i hendene, og la de to ytterste personene


Macbeth: Frozen Scenes

Macbeth: Frozen Scenes Macbeth: Frozen Scenes Using Frozen Scenes There are several ways to use these scenes 1. Along with the scene one can give the students the lines from the play and ask them to perform their scene with


klassisk angoragenser classic angora sweater

klassisk angoragenser classic angora sweater klassisk angoragenser classic angora sweater / NORSK Størrelser XS (S) M (L) XL (XXL) Garn Pickles Angora 150 (175) 200 (225) 250 (275) g Pinner 80 og 40 cm rundpinne og


Regler under svømmetrening! ENGLISH BELOW

Regler under svømmetrening! ENGLISH BELOW Regler under svømmetrening! ENGLISH BELOW Siden vi i det siste har vært ganske mange på treningene, har det vært litt kaos, og vanskelig å få trent bra. Derfor vil jeg her forklare noen regler som dere


lytte etter og bruke engelske språklyder gjennom praktiskestetiske gi eksempler på noen situasjoner der det kan være nyttig å kunne engelsk

lytte etter og bruke engelske språklyder gjennom praktiskestetiske gi eksempler på noen situasjoner der det kan være nyttig å kunne engelsk Årsplan i for 2.trinn 2014-2015 Faglærer Yngve Henriksen Læreverk: Stairs 2 Kompetansemål etter 2.årstrinn Ulike tema, delmål og arbeidsformer brukes på veien mot kompetansemålene fra K06 Språklæring Muntlig


Norsk (English below): Guide til anbefalt måte å printe gjennom plotter (Akropolis)

Norsk (English below): Guide til anbefalt måte å printe gjennom plotter (Akropolis) Norsk (English below): Guide til anbefalt måte å printe gjennom plotter (Akropolis) 1. Gå til print i dokumentet deres (Det anbefales å bruke InDesign til forberedning for print) 2. Velg deretter print


// Translation // KLART SVAR «Free-Range Employees»

// Translation // KLART SVAR «Free-Range Employees» // Translation // KLART SVAR «Free-Range Employees» Klart Svar is a nationwide multiple telecom store, known as a supplier of mobile phones and wireless office solutions. The challenge was to make use


stjerneponcho for voksne star poncho for grown ups

stjerneponcho for voksne star poncho for grown ups stjerneponcho for voksne star poncho for grown ups / NORSK Størrelser XS (S) M (L) Garn Pickles Pure Alpaca 300 (350) 400 (400) g hovedfarge 100 (100) 150 (150) g hver av


Trådløsnett med. Wireless network. MacOSX 10.5 Leopard. with MacOSX 10.5 Leopard

Trådløsnett med. Wireless network. MacOSX 10.5 Leopard. with MacOSX 10.5 Leopard Trådløsnett med MacOSX 10.5 Leopard Wireless network with MacOSX 10.5 Leopard April 2010 Slå på Airport ved å velge symbolet for trådløst nettverk øverst til høyre på skjermen. Hvis symbolet mangler må


Økologisk og kulturell dannelse i økonomiutdanningen

Økologisk og kulturell dannelse i økonomiutdanningen Økologisk og kulturell dannelse i økonomiutdanningen Dannelse på norsk fra ord til handling Professor Ove Jakobsen HHB/UiN Frihet med ansvar Om høyere utdanning og forskning i Norge NOU 2000:14 Det er


Come to praise. We have come to praise your name and give thanks for all things you ve done We lift our voices up to you You are worthy of our song

Come to praise. We have come to praise your name and give thanks for all things you ve done We lift our voices up to you You are worthy of our song Come to praise We have come to praise your name and give thanks for all things you ve done We lift our voices up to you You are worthy of our song We ve come to sing and give you praise We worship you


The regulation requires that everyone at NTNU shall have fire drills and fire prevention courses.

The regulation requires that everyone at NTNU shall have fire drills and fire prevention courses. 1 The law The regulation requires that everyone at NTNU shall have fire drills and fire prevention courses. 2. 3 Make your self familiar with: Evacuation routes Manual fire alarms Location of fire extinguishers


Hvorfor skal vi lære grammatikk?

Hvorfor skal vi lære grammatikk? 120 Grammar Hvorfor skal vi lære grammatikk? Grammatikk forteller oss hvordan vi setter sammen ord. Den forteller for eksempel at man kan si Jeg liker denne hesten, men at jeg like


Oversikt over The Beatles vinyl/singler/rekvisita Tittel (side A, side B) År Land Cover Pris Merknad

Oversikt over The Beatles vinyl/singler/rekvisita Tittel (side A, side B) År Land Cover Pris Merknad Oversikt over The Beatles vinyl/singler/rekvisita Tittel (side A, side B) År Land Cover Pris Merknad Singler She loves you, I'll get you Sept '63 NO Standard 75 1.opplag All my loving, I saw her standing



KVINNELIG OMSKJÆRING MER ENN BARE LEMLESTELSE? KVINNELIG OMSKJÆRING MER ENN BARE LEMLESTELSE? Kommunesamling tema folkehelse og barn og ungdom Trondheim, 20. november Thea Grydeland Ersvik /


K j æ r e b e b o e r!

K j æ r e b e b o e r! 1 K e y s e r l ø k k a Ø s t B o r e t t s l a g K j æ r e b e b o e r! D u h o l d e r n å i n nk a l l i n g e n t i l å r e t s g e n e r a l f o r s am l i n g i h å n d e n. D e n i n n e h o l d


GYRO MED SYKKELHJUL. Forsøk å tippe og vri på hjulet. Hva kjenner du? Hvorfor oppfører hjulet seg slik, og hva er egentlig en gyro?

GYRO MED SYKKELHJUL. Forsøk å tippe og vri på hjulet. Hva kjenner du? Hvorfor oppfører hjulet seg slik, og hva er egentlig en gyro? GYRO MED SYKKELHJUL Hold i håndtaket på hjulet. Sett fart på hjulet og hold det opp. Det er lettest om du sjølv holder i håndtakene og får en venn til å snurre hjulet rundt. Forsøk å tippe og vri på hjulet.


Familieeide selskaper - Kjennetegn - Styrker og utfordringer - Vekst og nyskapning i harmoni med tradisjoner

Familieeide selskaper - Kjennetegn - Styrker og utfordringer - Vekst og nyskapning i harmoni med tradisjoner Familieeide selskaper - Kjennetegn - Styrker og utfordringer - Vekst og nyskapning i harmoni med tradisjoner Resultater fra omfattende internasjonal undersøkelse og betraktninger om hvordan observasjonene


K j æ r e b e b o e r!

K j æ r e b e b o e r! K j æ r e b e b o e r! D e t t e e r i n n k a l l i n g e n t i l å r e t s g e n er a l f o r s a m l i n g. D e n i n n e h o l d e r b o r e t t s l a g e t s å r s m e l d i n g o g r e g n s k a


Gir vi de resterende 2 oppgavene til én prosess vil alle sitte å vente på de to potensielt tidskrevende prosessene.

Gir vi de resterende 2 oppgavene til én prosess vil alle sitte å vente på de to potensielt tidskrevende prosessene. Figure over viser 5 arbeidsoppgaver som hver tar 0 miutter å utføre av e arbeider. (E oppgave ka ku utføres av é arbeider.) Hver pil i figure betyr at oppgave som blir pekt på ikke ka starte før oppgave


Jæger Brand Manual JÆGER. Fersk og lokal HundemAT

Jæger Brand Manual JÆGER. Fersk og lokal HundemAT Jæger Brand Manual 2 Jæger Brand Manual 2 Brand Identity Target Audience 3 Logo 4 Colors 5 Typography 7 Infographic Brochure 9 Products 10 Point of Sale 11 Print Documents Brand Identity The brands name,


The internet of Health

The internet of Health The internet of Health! Biler, helse og fremtiden!! Velkon 2014, 22. October 2014 Nard Schreurs, IKT-Norge Få ut begrepet «pasient» av tanker om helse. Aldring 1980-2010 Menn 72 år til 79 år Kvinner 79


Microsoft Dynamics C5 Version 2008 Oversigt over Microsoft Reporting Services rapporter

Microsoft Dynamics C5 Version 2008 Oversigt over Microsoft Reporting Services rapporter Reporting Services - oversigt Microsoft Dynamics C5 Version 2008 Oversigt over Microsoft Reporting Services rapporter Summary Efterfølgende vises en oversigt over de rapporter som er indeholdt i Microsoft


BIBSYS Brukermøte 2011 Live Rasmussen og Andreas Christensen. Alt på et brett? -om pensum på ipad og lesebrett

BIBSYS Brukermøte 2011 Live Rasmussen og Andreas Christensen. Alt på et brett? -om pensum på ipad og lesebrett BIBSYS Brukermøte 2011 Live Rasmussen og Andreas Christensen Alt på et brett? -om pensum på ipad og lesebrett Prosjektet epensum på lesebrett Vi ønsker å: Studere bruk av digitalt pensum i studiesituasjonen.


Administrasjon av postnummersystemet i Norge Post code administration in Norway. Frode Wold, Norway Post Nordic Address Forum, Iceland 5-6.

Administrasjon av postnummersystemet i Norge Post code administration in Norway. Frode Wold, Norway Post Nordic Address Forum, Iceland 5-6. Administrasjon av postnummersystemet i Norge Frode Wold, Norway Post Nordic Address Forum, Iceland 5-6. may 2015 Postnumrene i Norge ble opprettet 18.3.1968 The postal codes in Norway was established in


Nærhetsetikk. Hva er nærhetsetikk? Hva er nærhetsetikk ikke? Hva slags nærhet snakker vi om? -Har nærhet etisk. Problemer med nærhetsetikk

Nærhetsetikk. Hva er nærhetsetikk? Hva er nærhetsetikk ikke? Hva slags nærhet snakker vi om? -Har nærhet etisk. Problemer med nærhetsetikk Nærhetsetikk Hva er nærhetsetikk? Hva er nærhetsetikk ikke? Hva slags nærhet snakker vi om? -Har nærhet etisk relevans? Problemer med nærhetsetikk Profesjonsetikk som nærhetsetikk? Hva er nærhetsetikk?


English translation:

English translation: 1 Da jeg flyttet til New York, malte jeg mange hjemløse ut fra fotografier jeg tok på gaten. Det ble til en serie jeg kalte «Faceless», for jeg malte dem uten ansikt. Etterhvert la jeg fra meg referansematerialet


STOP KISS av Diana Son Scene for en mann og to kvinner

STOP KISS av Diana Son Scene for en mann og to kvinner STOP KISS av Diana Son Scene for en mann og to kvinner Manuset ligger på NSKI sine sider og kan kjøpes på Sara and Callie are walking through New York City's West Village very late at


Samlede Skrifter PDF. ==>Download: Samlede Skrifter PDF ebook

Samlede Skrifter PDF. ==>Download: Samlede Skrifter PDF ebook Samlede Skrifter PDF ==>Download: Samlede Skrifter PDF ebook Samlede Skrifter PDF - Are you searching for Samlede Skrifter Books? Now, you will be happy that at this time Samlede Skrifter PDF is available


Newtons fargeskive. Regnbuens farger blir til hvitt. Sett skiva i rask rotasjon ved hjelp av sveiva.

Newtons fargeskive. Regnbuens farger blir til hvitt. Sett skiva i rask rotasjon ved hjelp av sveiva. Newtons fargeskive Regnbuens farger blir til hvitt. Sett skiva i rask rotasjon ved hjelp av sveiva. Se hva som skjer med fargene. Hvitt lys består av en blanding av alle farger. Når fargeskiva roterer


The Official Newsletter of Projects Abroad Bo. March 2013

The Official Newsletter of Projects Abroad Bo. March 2013 The Official Newsletter of Projects Abroad Bo ia March 2013 1 Editor s Letter Hi all, Welcome to the March edition of our Newsletter for Projects Abroad Bolivia. This newsletter aims to inform all ur volunteers


Dialogkveld 03. mars 2016. Mobbing i barnehagen

Dialogkveld 03. mars 2016. Mobbing i barnehagen Dialogkveld 03. mars 2016 Mobbing i barnehagen Discussion evening March 3rd 2016 Bullying at kindergarten Mobbing i barnehagen Kan vi si at det eksisterer mobbing i barnehagen? Er barnehagebarn i stand


Vurderingsveiledning SPR3008 Internasjonal engelsk Eleven gir stort sett greie og relevante svar på oppgavene i samsvar med oppgaveordlyden.

Vurderingsveiledning SPR3008 Internasjonal engelsk Eleven gir stort sett greie og relevante svar på oppgavene i samsvar med oppgaveordlyden. Answering Exam Tasks Currently the exam for this course has two tasks. Task 1 is referred to as the short task and task 2 is referred to as the long task. There are sometimes two parts to Task 1, a and


Forbruk & Finansiering

Forbruk & Finansiering Sida 1 Forbruk & Finansiering Analyser og kommentarer fra Forbrukerøkonom Randi Marjamaa basert på en undersøkelse gjennomført av TEMO/MMI for Nordea RESULTATER FRA NORGE OG NORDEN Nordea 2006-02-28 Sida


7 years as museum director at the Röhsska Museum, Göteborg. since February 2012 the museum director at the Sigtuna Museum, Sthlm

7 years as museum director at the Röhsska Museum, Göteborg. since February 2012 the museum director at the Sigtuna Museum, Sthlm 15 years in the advertising business 7 years as museum director at the Röhsska Museum, Göteborg since February 2012 the museum director at the Sigtuna Museum, Sthlm maksimere strategisk utviklingsplan


Nærings-PhD i Aker Solutions

Nærings-PhD i Aker Solutions part of Aker Motivasjon og erfaringer Kristin M. Berntsen/Soffi Westin/Maung K. Sein 09.12.2011 2011 Aker Solutions Motivasjon for Aker Solutions Forutsetning Vilje fra bedrift og se nytteverdien av forskning.



UNIVERSITETET I OSLO ØKONOMISK INSTITUTT UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Bokmål Eksamen i: ECON1210 Forbruker, bedrift og marked Exam: ECON1210 Consumer Behaviour, Firm behaviour and Markets Eksamensdag: 12.12.2014 Sensur kunngjøres:


PARABOLSPEIL. Still deg bak krysset

PARABOLSPEIL. Still deg bak krysset PARABOLSPEIL Stå foran krysset på gulvet og se inn i parabolen. Hvordan ser du ut? Still deg bak krysset på gulvet. Hva skjer? Hva skjer når du stiller deg på krysset? Still deg bak krysset Det krumme


Utstyr for avstandsmåling. Dommersamling 14. mars 2015 Stein Jodal

Utstyr for avstandsmåling. Dommersamling 14. mars 2015 Stein Jodal Utstyr for avstandsmåling Dommersamling 14. mars 2015 Stein Jodal Dommersamlingen 2012 Regulert i R 14-3 Kunstige hjelpemidler, uvanlig utstyr og uvanlig bruk av utstyr Anmerkning: Komiteen kan lage en


Nøtteknekkeren fem år etter

Nøtteknekkeren fem år etter part of Aker Geir Arne Drangeid Konserndirektør kommunikasjon 13. april 2011 2011 Aker Solutions Film skal legges inn her Slide 2 Formidlingskraft Aker er en viktig hjørnestensbedrift i det norske samfunnet


FRANK April, du var fantastisk. Og det mener jeg.

FRANK April, du var fantastisk. Og det mener jeg. REVOLUTIONARY ROAD av Justin Haythe Scene for mann og kvinne. Manuset finner du på A young couple living in a Connecticut suburb during the mid-1950s struggle to come to terms with their


Kurs i Nettverksbygging Edgar Valdmanis,MBA

Kurs i Nettverksbygging Edgar Valdmanis,MBA Kurs i Nettverksbygging Edgar Valdmanis,MBA Markedsdirektør, Den Norske Dataforening Bergen, 5.april 2011 Hvorfor nettverke? Du kan hjelpe andre med informasjon (om hvor de finner mer og rett informasjon)


Merak Un-glazed Porcelain Wall and Floor Tiles

Merak Un-glazed Porcelain Wall and Floor Tiles 6 Colours 3 es Absolute Collection 7 s Merak Un-glazed Porcelain Wall and Floor Tiles Merak includes seven sizes perfectly designed for seamless installation. 600 x 50mm 600 x 100mm 600 x 300mm 600 x 150mm


The Norwegian Citizen Panel, Accepted Proposals

The Norwegian Citizen Panel, Accepted Proposals PROGRAMMER NOTE: There are 4 ways question is asked. That is, each of these one of these 4 questions. Please be sure to use a truly random assignment method to determine


Oppfølging av etiske krav: Eksempel Helse Sør-Øst

Oppfølging av etiske krav: Eksempel Helse Sør-Øst Oppfølging av etiske krav: Eksempel Helse Sør-Øst Sauda, 21. september 2011 Grete Solli, spesialrådgiver, Helse Sør-Øst Magne Paulsrud, seniorrådgiver, Initiativ for etisk handel Helse Sør-Øst: nye etiske


3/1/2011. I dag. Recursive descent parser. Problem for RD-parser: Top Down Space. Jan Tore Lønning & Stephan Oepen

3/1/2011. I dag. Recursive descent parser. Problem for RD-parser: Top Down Space. Jan Tore Lønning & Stephan Oepen INF2820 Datalingvistikk V2011 TABELLPARSING Jan Tore Lønning & Stephan Oepen 1. mars 2011 2 I dag Oppsummering fra sist: Recursive-descent og Shift-reduce parser Svakheter med disse Tabellparsing: Dynamisk


bråkmakergenser troublemaker sweater

bråkmakergenser troublemaker sweater bråkmakergenser troublemaker sweater / NORSK Størrelser Jente eller gutt 1 (2) 3/4 (5/6) 7/8 (10) 12 år Garn Pickles Pure Thin Alpaca Jente: 300 (350) 400 (500) 550 (600)



SERVICE BULLETINE 2008-4 S e r v i c e b u l l e t i n e M a t e r i e l l Materiellsjef F/NLF kommuniserer påminnelse omkring forhold som ansees som vesentlige for å orientere om viktige materiellforhold. Målgruppen for Servicbulletinen


Engelsk gruppe 2 høsten 2015

Engelsk gruppe 2 høsten 2015 Engelsk gruppe 2 høsten 2015 I løpet av høsten har vi jobbet med disse tingene på engelsk: Tall - numbers Norsk - Norwegian Engelsk - English Mitt språk -My language 1 en one 2 to two 3 tre three 4 fire


Kartleggingsskjema / Survey

Kartleggingsskjema / Survey Kartleggingsskjema / Survey 1. Informasjon om opphold i Norge / Information on resident permit in Norway Hvilken oppholdstillatelse har du i Norge? / What residence permit do you have in Norway? YES No


Hvorfor nettverke? Bedre Nettverksbygging Med smart bruk av LinkedIn Edgar Valdmanis,MBA. Markedsdirektør, Den Norske Dataforening

Hvorfor nettverke? Bedre Nettverksbygging Med smart bruk av LinkedIn Edgar Valdmanis,MBA. Markedsdirektør, Den Norske Dataforening Bedre Nettverksbygging Med smart bruk av LinkedIn Edgar Valdmanis,MBA Markedsdirektør, Den Norske Dataforening DND, Faggruppen CRM, 28.mai 2013 Hvorfor nettverke? Du kan hjelpe andre med informasjon (om





Spørsmål til Lady Gaga v/silje Kristin Erlandsen

Spørsmål til Lady Gaga v/silje Kristin Erlandsen Spørsmål til Lady Gaga v/silje Kristin Erlandsen 1. Hvorfor tror du at Lady Gaga har blitt så populær? 2. Hva tror du Lady Gaga ønsker å oppnå med sin sjokkerende klesstil og image? Hva synes du om måten


Eksamensoppgave i GEOG Menneske og sted I

Eksamensoppgave i GEOG Menneske og sted I Geografisk institutt Eksamensoppgave i GEOG1000 - Menneske og sted I Faglig kontakt under eksamen: Britt Engan Dale Tlf.: 73 59 19 14 Eksamensdato: 18.12.2014 Eksamenstid: 4 timer Studiepoeng: 7.5 Sensurdato:


Trådløsnett med Windows XP. Wireless network with Windows XP

Trådløsnett med Windows XP. Wireless network with Windows XP Trådløsnett med Windows XP Wireless network with Windows XP Mai 2013 Hvordan koble til trådløsnettet eduroam med Windows XP Service Pack 3? How to connect to the wireless network eduroam with Windows XP



STILLAS - STANDARD FORSLAG FRA SEF TIL NY STILLAS - STANDARD FORSLAG FRA SEF TIL NY STILLAS - STANDARD 1 Bakgrunnen for dette initiativet fra SEF, er ønsket om å gjøre arbeid i høyden tryggere / sikrere. Både for stillasmontører og brukere av stillaser. 2 Reviderte


Welcome to one of the world s coolest golf courses!

Welcome to one of the world s coolest golf courses! All Photography kindly supplied by Velkommen til Verdens råeste golfbane! Lofoten Links er en spektakulær 18-hulls mesterskapsbane som ligger vakkert i naturen. Her kan sola


ENGELSK. 1. Vi registrerer hjerterytmen din. We are measuring your heart rate. 2. Vi måler blodtrykket ditt. We are measuring your blood pressure.

ENGELSK. 1. Vi registrerer hjerterytmen din. We are measuring your heart rate. 2. Vi måler blodtrykket ditt. We are measuring your blood pressure. Side 1 av 8 1. Vi registrerer hjerterytmen din. We are measuring your heart rate. 2. Vi måler blodtrykket ditt. We are measuring your blood pressure. 3. Vi måler oksygenmetningen i blodet. We are measuring


SmartPass Mini User Manual BBNORGE.NO

SmartPass Mini User Manual BBNORGE.NO SmartPass Mini User Manual BBNORGE.NO Intro Welcome to the usermanual for your SmartPass Mini system. The first time you start the SmartPass you have to request a License. This is to regiser your license


I can introduce myself in English. I can explain why it is important to learn English. I can find information in texts. I can recognize a noun.

I can introduce myself in English. I can explain why it is important to learn English. I can find information in texts. I can recognize a noun. Pets and vets The key to communication The key to communication 34-35 36 Kommentere eget arbeid med å lære engelsk emner Uttrykke seg med flyt og sammenheng tilpasset formål og situasjon Uttrykke og begrunne


Manuset ligger på NSKI sine sider, men kan også kjøpes på

Manuset ligger på NSKI sine sider, men kan også kjøpes på STOP KISS av Diana Son Scene for to kvinner. Manuset ligger på NSKI sine sider, men kan også kjøpes på Sara and Callie are walking through New York City's West Village very late at night,


Eiendomsverdi. The housing market Update September 2013

Eiendomsverdi. The housing market Update September 2013 Eiendomsverdi The housing market Update September 2013 Executive summary September is usually a weak month but this was the weakest since 2008. Prices fell by 1.4 percent Volumes were slightly lower than



UNIVERSITETET I OSLO ØKONOMISK INSTITUTT UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Exam: ECON320/420 Mathematics 2: Calculus and Linear Algebra Eksamen i: ECON320/420 Matematikk 2: Matematisk analyse og lineær algebra Date of exam: Friday, May


Side 2 af 12 in identitet vil holdes skjult. Les om retningslinjer for personvern. (Åpnes i nytt vindu) 1) Navn på gruppen:

Side 2 af 12 in identitet vil holdes skjult. Les om retningslinjer for personvern. (Åpnes i nytt vindu) 1) Navn på gruppen: Side 1 af 12 Nordisk Tilsynskonferanse 2016 ag 1 Proporsjonalitet og rimelighet ruppeoppgaver På de neste sidene finner du 5 bilder hentet fra hverdagen som inspektør. jør din egen vurdering og dis sidemannen


Årsplan i engelsk - 2. klasse 2014-2015

Årsplan i engelsk - 2. klasse 2014-2015 ..Antall timer pr uke:1 time Lærere: Gro Åkerlund Læreverk: Stairs My English Book 1+2 Nettstedet: Eget vedlegg om lokal plan. Årsplan i engelsk - 2. klasse 2014-2015 Grunnleggende


Smarte hjem konferansen 2015. Kan vi konkurrere med de store?

Smarte hjem konferansen 2015. Kan vi konkurrere med de store? Smarte hjem konferansen 2015 Kan vi konkurrere med de store? Om oss - Etablert 2003 - Utvikler egen HW og SW - Fokus - DIY - Strømsparing #smartehjem Networks for devices connected to the internet (think


WWW.CERT.DK. Introduction to DK- CERT Vulnerability Database

WWW.CERT.DK. Introduction to DK- CERT Vulnerability Database Introduction to DK- CERT Vulnerability Database By Peter Rickers and Mikael Stamm 1 Fundamental Idea Securing of networks, in-house and externally Savings for the costumers Making admission to the correct


Bestille trykk av doktoravhandling Ordering printing of PhD Thesis

Bestille trykk av doktoravhandling Ordering printing of PhD Thesis Bestille trykk av doktoravhandling Ordering printing of PhD Thesis Brukermanual / User manual Skipnes Kommunikasjon PhD Thesis NTNU LOG IN NOR: Gå inn på siden, eller


Du kan bruke det vedlagte skjemaet Egenerklæring skattemessig bosted 2012 når du søker om frikort.

Du kan bruke det vedlagte skjemaet Egenerklæring skattemessig bosted 2012 når du søker om frikort. Skatteetaten Saksbehandler Deres dato Vår dato 28.10.2011 Telefon Deres Vår referanse For information in English see page 3 Skattekort for 2012 Du fikk helt eller delvis skattefritak ved likningen for


Reliable RT processing @ Spotify

Reliable RT processing @ Spotify Reliable RT processing @ Spotify Pablo Barrera February 5, 2014 Spotify 3 Spotify the right music for every moment over 6 million paying customers over 24 million active users each


Hvordan føre reiseregninger i Unit4 Business World Forfatter:

Hvordan føre reiseregninger i Unit4 Business World Forfatter: Hvordan føre reiseregninger i Unit4 Business World Forfatter: Denne e-guiden beskriver hvordan du registrerer en reiseregning med ulike typer utlegg. 1. Introduksjon 2. Åpne vinduet


...oer the world... Eric Skytterhom Egan. eight text pieces. for 3 or more players

...oer the world... Eric Skytterhom Egan. eight text pieces. for 3 or more players ...oer the world... eight text pieces for 3 or more players Eric Skytterhom Egan 2011 Freeeeeeeeeeeeeeeeeeeefrong that train again weeping tone once in the dear deaead days beyond recall close my eyes


Social Media Insight

Social Media Insight Social Media Insight Do you know what they say about you and your company out there? Slik fikk Integrasco fra Grimstad Vodafone og Sony Ericsson som kunder. Innovasjon og internasjonalisering, Agdering


SUPERTOOTH BUDDY MANUAL NORSK. The hidden energy supertooth buddy manual norsk online manual

SUPERTOOTH BUDDY MANUAL NORSK. The hidden energy supertooth buddy manual norsk online manual SUPERTOOTH BUDDY MANUAL NORSK The hidden energy online manual SUPERTOOTH BUDDY MANUAL NORSK Most websites likewise have a sophisticated database, containing new cost-effective parts for all those styles


Baltic Sea Region CCS Forum. Nordic energy cooperation perspectives

Baltic Sea Region CCS Forum. Nordic energy cooperation perspectives Norsk mal: Startside Baltic Sea Region CCS Forum. Nordic energy cooperation perspectives Johan Vetlesen. Senior Energy Committe of the Nordic Council of Ministers 22-23. april 2015 Nordic Council of Ministers.


Jørn Kristiansen MET Norway.

Jørn Kristiansen MET Norway. Dissemination of weather and climate information to various users of Yr : Experiences and strategy for data access, commercial use, attribution and data policy. Jørn Kristiansen MET Norway


Søker du ikke om nytt frikort/skattekort, vil du bli trukket 15 prosent av utbetalingen av pensjon eller uføreytelse fra og med januar 2016.

Søker du ikke om nytt frikort/skattekort, vil du bli trukket 15 prosent av utbetalingen av pensjon eller uføreytelse fra og med januar 2016. Skatteetaten Saksbehandler Deres dato Vår dato 26.10.2016 Telefon Deres Vår referanse For information in English see page 3 Skattekort for 2016 Du fikk helt eller delvis skattefritak ved likningen for


DecisionMaker Frequent error codes (valid from version 7.x and up)

DecisionMaker Frequent error codes (valid from version 7.x and up) DecisionMaker Frequent error codes (valid from version 7.x and up) DM Frequent Error Codes Bisnode Credit IT 03.02.2014 1 (5) CONTENTS 1 Target... 3 2 About this document... 3 3 Error codes an messages...


Taylor Swift «Mean» Klassemøtet

Taylor Swift «Mean» Klassemøtet Taylor Swift «Mean» Klassemøtet Taylor Swift - Mean - prosess Sangen «Mean» er laget av Taylor Swift og er på hennes tredje studioalbum Speak now (2010). Kjøp sangen eller CD-en. Videoen med sangen kan


Avdelingslederen den nye pedagogiske lederen?

Avdelingslederen den nye pedagogiske lederen? Møte i kvalitetsnettverket, Skien 17. september 2015 Avdelingslederen den nye pedagogiske lederen? Førsteamanuensis Marit Aas Agenda 10.00-11.00: Internasjonale trender og politikkutforming



OSLO OPEN 2 24 MÅL FELT OSLO OPEN 2 24 MÅL FELT 14. 15. JUNI 2012 I OSLO (English version at page 4) 2 24 FITA* Arrowhead SK Vidar innbyr til internasjonalt feltstevne på vår feltbane ved Sørmarka utenfor Oslo 14.- 15. juni 2014.





DESEMBER 2010. Så er det altså tid for å sende ut planene for desember. Tiden går fort men vi er klare for juleforberedelser, og gleder oss veldig!

DESEMBER 2010. Så er det altså tid for å sende ut planene for desember. Tiden går fort men vi er klare for juleforberedelser, og gleder oss veldig! DESEMBER 2010 Så er det altså tid for å sende ut planene for desember. Tiden går fort men vi er klare for juleforberedelser, og gleder oss veldig! Det viktigste for oss i desember er å ta det med ro! Vi


Solidaritet har vært et slagord i fagbevegelsen siden 1848 Fra internasjonalisme til inter nasjonalisme i

Solidaritet har vært et slagord i fagbevegelsen siden 1848 Fra internasjonalisme til inter nasjonalisme i Workers of the world, unite? Solidaritet har vært et slagord i fagbevegelsen siden 1848 Fra internasjonalisme til inter nasjonalisme i etterkrigstiden Nasjonsbygging og nasjonalt trepartssamarbeid Konsekvenser


Presenting a short overview of research and teaching

Presenting a short overview of research and teaching Presenting a short overview of research and teaching Portuguese in Norway at university level Diana Santos Romanskfagråd møte, Oslo, 31 October 2014 Research Research under Linguateca


Juridiske aspekter ved publisering i åpne institusjonelle arkiv

Juridiske aspekter ved publisering i åpne institusjonelle arkiv Juridiske aspekter ved publisering i åpne institusjonelle arkiv Professor dr juris Olav Torvund Publisering i åpne institusjonelle arkiv Førstegangspublisering Masteroppgaver Doktoravhandlinger (?) Grålitteratur


K j æ r e b e b o e r!

K j æ r e b e b o e r! K j æ r e b e b o e r! D u h o l d e r n å i n n k a l l i n g e n t i l å r e t s g e n e r a l f o r s am l i n g i h å n d e n. D e n i n n e h o l d e r b o r e t t s l a g et s å r s b e r e t n i


Examination paper for SØK2009 International Macroeconomics

Examination paper for SØK2009 International Macroeconomics Department of Economics Examination paper for SØK2009 International Macroeconomics Academic contact during examination: Joakim Prestmo Phone: 73 59 83 37 Examination date: 04.12.2015 Examination time (from-to):


En ny verden Og hvordan skal vi regulere den?

En ny verden Og hvordan skal vi regulere den? En ny verden Og hvordan skal vi regulere den? Oslo, 5. november 2015 Frode Lillebakken, juridisk direktør TeliaSonera Norge Dagens TeliaSonera verden Subsidiaries Associated companies Net sales SEK 101.1


Elektronisk innlevering/electronic solution for submission:

Elektronisk innlevering/electronic solution for submission: VIKINGTIDSMUSEET Plan- og designkonkurranse/design competition Elektronisk innlevering/electronic solution for submission: Det benyttes en egen elektronisk løsning for innlevering (Byggeweb Anbud). Dette


Medisinsk statistikk, KLH3004 Dmf, NTNU 2009. Styrke- og utvalgsberegning

Medisinsk statistikk, KLH3004 Dmf, NTNU 2009. Styrke- og utvalgsberegning Styrke- og utvalgsberegning Geir Jacobsen, ISM Sample size and Power calculations The essential question in any trial/analysis: How many patients/persons/observations do I need? Sample size (an example)


buildingsmart Norge seminar Gardermoen 2. september 2010 IFD sett i sammenheng med BIM og varedata

buildingsmart Norge seminar Gardermoen 2. september 2010 IFD sett i sammenheng med BIM og varedata buildingsmart Norge seminar Gardermoen 2. september 2010 IFD sett i sammenheng med BIM og varedata IFD International Framework for Dictionaries Hvordan bygges en BIM? Hva kan hentes ut av BIM? Hvordan



UNIVERSITETET I OSLO ØKONOMISK INSTITUTT UNIVERSITETET I OSLO ØKONOMISK INSTITUTT Eksamen i: ECON320/420 Matematikk 2: Matematisk analyse og lineær algebra Exam: ECON320/420 Mathematics 2: Calculus and Linear Algebra Eksamensdag: Onsdag 6. desember


Søker du ikke om nytt frikort, vil du bli trukket 15 prosent av din pensjonsutbetaling fra og med januar 2014.

Søker du ikke om nytt frikort, vil du bli trukket 15 prosent av din pensjonsutbetaling fra og med januar 2014. Skatteetaten Saksbehandler Deres dato Vår dato 31.10.2013 Telefon Deres referanse Vår referanse For information in English see page 3 Skattekort for 2014 Du fikk helt eller delvis skattefritak ved likningen
