k, 1 Fisk oa ~oteter i nord ..,. -, i<..-,:. -, 9 GRYTE :z..,z! (4 p& - -,. ',:*.. '

Størrelse: px
Begynne med side:

Download "k, 1 Fisk oa ~oteter i nord ..,. -, . -... . -- i<..-,:. -, 9 GRYTE :z..,z! (4 p& - -,. ',:*.. '"



2 k, 1 Fisk oa ~oteter i nord.,.:; Kok potetene maf9. Legg fisken i en RKES FRANSK- -A.,. IHUGEUTCJIVE A..;:. kjekvarni safrantråder i en varm ; GRYTE :z..,z! (4 p& - -,. ',:*.. '...:.,., panne og hell over l dl kokende vann. (4 pers.). -- i<..-,:. -, 9.~ -L, :--i,, -,?:L Gi etoppkokhdles over fisken sam- Y* Herlig mettende middag. '..- '. '" men med hvitvin. la dette få småpu- Spennende gjestemat ps J -- '.' 800g utvannet kfippfisk..y:.:': 'l>.i. i tre/trekke i minutter etter tyk- lørdagskvelden.'...':: (utvannetminst 12 timr) ' - keke fisken. Pass ps at varmen ikke, -~. 1ksk..,.,! g Gulbye eller mondelpotet Mir Fot sterk. kveg av og til kjelen. 1-2 knnikd hekhyissmdekiskiver '.: :; Legg opp fisk og poteter tallerke- 16 små Gdbye (evrattepoteter) b..~ hardkokte egg,: 4... ' ner. Fordel sol&&zde tomater. ixjk,,...-, 2-3 gu~mer,,.l:: 4 ~ s t tomater ~ egg og oliven ~ over - og server.. s i L;, i:,,.:,,i' ~ 2 sntpoteter.-- y.?'. -h olkdje og pepper :., :. : squash 1-2 klypeusofran (w gykemie). :;-".-?I-. =- 8 -,.-.:'.,.,,.. : ; \ r '?,'..-k L,-=..,,...,.. -. '..' dlM~hvitvM :.t., ,.. -. : r :,.i.,.,,-.,.-l.,,=*,- 8.I...' i,':..:-..,..-,: >.J:..æ. - :-0- 'L,... b 7:: fiskekruft, -', hav~itogpeppert?akvh~~..,. -, enskvettmtwe en skvett tan hvitvin w 2 a konjakk eiler akevitt 400 g #O g kveke eller tonkeim 2 ledd av kokt kongekrabte Skjaer renset lek og fennikel i to,& i skiver. Skreite gulmrtter i skiver.vasme s d poteter forblt Me, mm deles i to, tre biter. Dette fress i olivenolje i en vid kjde.hell i fiskekraft si3 det dekker pdt La koke opp Søtpotetene &les i to ps langs, deretter i 1 cm tykke

3 flåkeslott på Senja m sahmwme~tasktitrai - pame.øsowi&tvemi kiaftfrafra~p ienog haalttilbakei IgeknSmaktw med sak, pepper og hvith.hd I litt We.TiisettRJrenigodemunbiter og haittrekkeet par minutter. Rwkrabbenogfindelkjmttet. riseaes tw SI^ (W w~mnen med konjakw-. La alt Mi Qjennommtogsenret.pIrntqjerne

4 Smakfulle retter - enkle å li a?%menes Kjdsken" wtiv kokk. (Gnist Design)


6 i Noen L *P Sma ksri k slow food + a C.$L4gw2F.,;:b %.d+g,u - i;z.tn L ~, ~ ~ ~ som ikke, -,<w:-px.- -> LY. T-A i,- - L d n U'. <.. går av moten' matretter blir bare klassikere. Så gode er de! Om de egentlig stammer fra Frankrike eller Italii etler Russland, har de rukket B bli kjente og kjære i mange andre land ogd. Og hva kan smake bedre rundt helgens hyggelige vinterbord enn nettopp kjent kjetbnat fra en gryte som har stått og putret p4 plate elter i ovnen i flere timer? Her kommer ekte slow fwd, som mor og mormor også serverte som ssndagsmiddag. w- w. > -,=m- KLASK USXHUICO TK 4 (Gryte med kalveskank i skiver) En ekte.wiener, opprinnelig fra Lwnbwdia. Ossobuco betyr egentlig "knoke med hull i: Dtt matre kjmttet serve-,li res med safranris der t& fdge av mrdampede grrann- saker. Husk 8 ha noen smale skjeer for hdinden sri at dere kan 13 med ai den kraftige* gode margen. 4 skiwrkakkmkå ca.2wg (med margbein), ee storfe 2 stwe gukter L 'k L'*e- b, i Ca. 2 hviti8kbdter 2-3 stjlker &leri 1 bunt persiik smwr og divemlfi vilt og pepper fra kvern boks grovhakkede tornarer (400gJ?41 god UREMIXATA: l sitron, 1 bunt hwitkkkbdter I I'. * Skyll kjrattskiww under rcnnendc vann sai rv bdiser forsvinner.twk dem med Skrell gulfatter, bk og hvitlgik.vask selkri. Finhakk dt. Skyll persille og rist. Finhakk bladene. Sett en raus gryte platen.varm app 1 ss s m og 1 ss olje. Legg i kjemkiverte og brun &m kraftig p& slk kanter. Snu d stekespade og la andre sidm fa "&t samme: Ta s k i i opp av gryten og krydre &m. hes hakkede grmh og persik i gryten. Hell innholdet i tomatboksen -. med kraft, krydre m sdt og pepper. Skru ned til middds varme og la -en koke samm ca. 20 minutter, til &n er ri dusert. Da legga! kjøttskne tilbake, ved sida w kamire. Ddtk dem med saus. Legg grytdokket pd og skru ned varmen til svak. La kjmet surre s k i a. 1 H time. Imem lages gremdata - godt tir? iwst sitronen under varmt vann. Gni den mr. SkW a tynt lag av skallet, bare det gule.skyu persille og napp ar bladene. Skrell hvitbk.! Bland og hakk alt smatt. Ha blendingen i en bolk. Gremdata gir måltidet en frisk smak kurer ossotmo med godt bred eller toast og dryss gre- 1 mdata over lik kw du spiser. b nr J I

7 Fra gammelt w w da skikk at Alaccs kvimeren dag i vaskdagm brakte sine gryter til bakeriene MI bredene var &&g bakt).debksattkinibakamwm. kunne ~~ scp m kleuni kenogviteatniddagrnvwwrdcr kqnmn. 7s g rent M0glskit)mXdrarw iskimi blodiena fm l. tirniathist I imntmrbk?4mim it nellik IOhdeswrte~n salt ca.5dltsnhwn 14lkgstorepoteler 7sghveicmal CIrJar alt kjoitet i &ne terninger. WLonddetrncallekogphtterien storb.rhe,urniihvct~og knus tdan.wmles ned s-arnrnen med. tiinbbf*, burlxertda$, nec ia pcppnkomdgdtwvkini owxogblandmmmmrmdktt hbnd. %f&s i kjshkapet, tiidekker i 12~.SrrUiyaaetniiogda Forrwnn~tll190grvamre. ~ Q g v a r k ~ e r. ~ d m i %crnt)rldccswx.ta opp kjwtaog nnk det. en. rarrildfa#fom/~.borklnocn over-% a til alz w ~~opp*potcterpiimppen. U0 mwsnabqn Mer. Ref?f3gmlicnbo#rmednok VamWc~Smidig~~titen L*pgfo#eav*.~agpmtneQ~ttl<oZ dsnsrterteft.idatte~aldtslutageog ~ * a t. ~ s ~ ~ i k l t c siverutsomifamp).la mendi wnen2hth3timer.tamenutw ovnenogmrdlrd<tefra gsylclbomi. VIN TIL GR-R ~ ~ B m l l s ~ 260rl. Vinen har rad farge med Rotert kant Intens og fruktig amma, og fremtre dende elementer av baer og plommer, Konsentrert saftig frukt, myke tanniner og lang etkrsmak. God til kraftige grytemer og til vik (og& lam). Denne spanske vinen fra cimktet Yecia har Christer Berens biandet sammen med vinmaker Mariano Lopa. Pris 89,90. Et annet godt valg t0 gryteretter og pasta: Awathot001- smaksrik og velkanrnuwt vin fra R l h del Duem,!Spania. Vakker nibind farge, med rike aromaer fra rede baer. Konsentrert med ekgante krpmertoner, velbaiansert med lang ettentbak. Pris e

8 BJFF rroo~#~an~4 (Migrye fra Russland) Mogpeppcr 2dpdkjdimft &te sitran Znsatsennep ca. 3 dl serefmm Grev Akxedw fra m russisk addsfamtlk som dm jern- &i UTd.Hanvarsm&mnntil Rmna p4 tngynipelsen av 1-k rn8kkefpdk 0gw-n- Det varder han flkk~gsieneoppkir mat og vin i mer kontinental rehiing. I sitt paiass i St. FWenburg 'hukrte han forfattere og kunstnere til spise med seg. Strogmdhe hawe drivhus og kunne servere all slags frukt og grmrimkcr midt på kame4te Ww3.9 h n dem askt atyrs p4 vintm,om de bie servert gryten mk QZI pepper. Hg I0ken i gryten. Spe ikke.h4en hams kokk fant $Itfall opp medkraft,~htiittocl,mnepog mme,og la smien surm noen denncretnn,meetdrenem&td mlnutter tu den tykner.smak godt til som sd med mm i $en gomme og dem lanrne man raskt oppkok. Serverts W hjemme n y t e u t e n ~ m ~ % t e ~ wsr~po-~ m ~ ~ Strimkt bilf kold mwr i "sietam* (russisk sw fl- som minner m dr saerrmrne) var noe Ongen andre M "nei takk"til- kiler... (Klasskk -tyte til 6) EtrnbmwdigmWudvIengang inntak p4 et -hus i Bourhpgne begynte med Jambon persiilt! (Aspik m?!d ratt skinke ag persille) og fortsstte med en oksekj~ryle, muf Bourguipnon rom nem tok pusten fraab~wfikkopgrk~eg laps gryteipetpwgmpcrhvcrvintar.ndr vi har tid id helg, fw wnner.vi hw bytrcit ut origind«lr stridede svitwimg mot baconskiver, men dks a vi tro mot appshifm. Vanml ssd~igt)rte~41)ogstek konet i strimler til gylknt og spren.ta gpp og sett til side.tii ZCi g r m og la lek W surre over s d vanne tii gylten. Snu ndi m da. Det tar a. 10 minuttata opp med hddeiv. Skjar i store terninger og stek dein i porsjoner i gryten. SI& i brennevin, og ett minutt senara VM. Skrap M tiden IPw det brune etter stekingen med en tfaje.tm p4 vinen og vent til ffammene hor sluknet. Ha I51pimt tiibakc i gryten og bdetfdwopp. LcggdMkag la det tnadre over svak varm et par tinier (minst). imens trimrnes sapp. Smelt 25 p m#wi~ ~lwogti~se~so#3oq litt sitronsaft. Krydre m salt og pep ogiivarkyohrrrmisdrctut. Hawmtqlokigm,oglaaltA hekke minst en W time til.ta opp kjettm og sopp med huilsleiv og la sawm.fa a oppkok Bland tykning* mdetmedenvan~ogrmdtt inn i sausen. La det putre sterk vanne et par minutar til tykkog glattsausha kjetzsoppogiaktitilt#- ke og fordd baconet over. La ait Mi skilfg gjenwmarmt Semures direkte fra gryten med m lyst bad t tykke skiver til.

9 UNGARSK GOULAXH (6 personer) Hvis du noen gang har besøkt Ungam,vll du vite at goulaxh kan lages pil mange mdter. Den kan være suppe, gryte med mye kraft eller en tørrere "lapskaus? For det meste brukes nok storfekjøtt til denne retten, men vi har og& opplevd d fa god goulasch med svinekjøtt. Det eneste som alltid er til stede,er paprikapulver - og gulrot! Oppskriften her liker vi svært godt. 2 ss smør 50 g grovhakket Ink 2 pressede hvai0kbciter 3 ss paprikapulver dr0p 1 kg lapskauskjøtt -storfe eller svin i terninger 1 h karve 1 I kbttkramwljong salt og pepper h kvern 1 boks hakkede tomater (400 g) 225 g smd sjampinjonger M h oregono.- l ss maisenna R& og gul paprika i strimler Varm smar i en stor kjelelgryte. Fres lek og hvitløk lysebrunt.tilsett paprikapulwr og mr godt sarnmen.tilsett kjøtt, karve, kraft, lin salt og pepper. La det fdr smdputre en times tid. Tilsett tomatene, stekte hele sopp og oregano. La det rekke ca. 34 time til - uten lokk. Bland maisenna med en vannskvett og hell det i kjelen i en tynn strale under omrøring. La det M smakoke videre. Legg i paprikastrimlene og smak til.skal trekke til sausen tykner noe. Serveres med delikatessepoteter og/etler bred. ' L J - a RASK VINTERGRYTEIPANNE (til 4) Surr strimlet Wtt og lek 5 smwfolje. La væsken dampe bort.tilsect varlek i strimler og hakket chili. Hell pd flete, smak til med sek og pepper. La alt trekke en kort tid det blir skikkelig gjennmwarmt. Serveres med potetmos eller pasta. I

Fiskegryte med limetouch Onsdag MIDDELS 20 40 MIN 4 PORSJONER

Fiskegryte med limetouch Onsdag MIDDELS 20 40 MIN 4 PORSJONER Fiskegryte med limetouch Onsdag MIDDELS 20 40 MIN 300 g laksefilet i terninger 4 stk finhakkede sjalottløk 1 2 stk finhakket rød chili saft og finrevet skall av 1 stk lime 1 ss margarin 3 dl vann 2 dl


Grillet laks med squashsalat og mynteyoghurt Onsdag Mer informasjon om oppskriften 4 PORSJONER

Grillet laks med squashsalat og mynteyoghurt Onsdag Mer informasjon om oppskriften 4 PORSJONER Grillet laks med squashsalat og mynteyoghurt Onsdag Mer informasjon om oppskriften 600 g laksefilet 1 ts salt 2 ss tandoorikrydder 1 ss rapsolje MYNTEYOGHURT: 3 dl matyoghurt 2 ss finhakket frisk mynte


Hjemmelagde fiskepinner Onsdag 4 porsjoner 20 min Enkelt

Hjemmelagde fiskepinner Onsdag 4 porsjoner 20 min Enkelt Hjemmelagde fiskepinner Onsdag 4 porsjoner 20 min Enkelt 600 g torskefilet, uten skinn og bein 4 ss hvetemel 0,5 ts pepper 1 stk egg 2 ss melk 1 dl griljermel 3 ss margarin, flytende Potetmos 5 stk potet


Lynstekt kylling i kokosmelk Onsdag

Lynstekt kylling i kokosmelk Onsdag Lynstekt kylling i kokosmelk Onsdag Ingredienser - 4 personer 2 3 kyllingfileter 2 bakepoteter 1 brokkolihode 1 frisk chili 2 fedd hvitløk 2 ss rapsolje 1 ts karri 1 boks kokosmelk Saften av en sitron


Stekt laks med potetmos Onsdag 4 porsjoner 20-40 min Enkelt

Stekt laks med potetmos Onsdag 4 porsjoner 20-40 min Enkelt Stekt laks med potetmos Onsdag 4 porsjoner 20-40 min Enkelt INGREDIENT LIST 600 g laksefilet, uten skinn og bein smør Potetmos 6 stk potet 1 dl melk 1 ss smør Tilbehør brokkoli Framgangsmåte 1 Skjær laksen


Reker med couscous Onsdag 4 porsjoner 20 min Enkelt

Reker med couscous Onsdag 4 porsjoner 20 min Enkelt Reker med couscous Onsdag 4 porsjoner 20 min Enkelt INGREDIENT LIST 400 g reker, uten skall 4 dl vann 1 terning grønnsaksbuljong 1 ss olje 4 dl couscous 2 fedd hvitløk 2 stk paprika, rød 1 ss olje 125


Wrap med laks og mangosalat Onsdag 4 porsjoner 20-40 min Enkelt

Wrap med laks og mangosalat Onsdag 4 porsjoner 20-40 min Enkelt Wrap med laks og mangosalat Onsdag 4 porsjoner 20-40 min Enkelt INGREDIENT LIST 600 g laksefilet, uten skinn og bein 2 ss margarin, flytende 1 ts salt 0,5 ts pepper Mangosalat 1 stk mango 0,5 stk chili,


Gulrotsuppe Onsdag. https://www.tine.no/oppskrifter/middag-og-hovedretter/supper/gulrotsuppe-med-ingefær

Gulrotsuppe Onsdag. https://www.tine.no/oppskrifter/middag-og-hovedretter/supper/gulrotsuppe-med-ingefær Gulrotsuppe Onsdag Tid 25 min TIPS: Noen poteter har mer stivelse i seg enn andre. Stivelse gjør at suppen tykner. Synes du suppen blir for tykk kan du ha i litt mer vann. - Du trenger 1 kg gulrot 5 hvitløksfedd


Kylling med ananas og kokosris (Onsdag 17/9 14)

Kylling med ananas og kokosris (Onsdag 17/9 14) Kylling med ananas og kokosris (Onsdag 17/9 14) ENKEL 20 40 MIN Ris kokt i kokosmelk får en deilig, eksotisk smak som passer godt til kylling. Stekt ananas med kokos setter prikken over i-en. 4 Porsjoner


utsøkt kraft buljong til klassisk mat

utsøkt kraft buljong til klassisk mat utsøkt kraft til klassisk mat buljong mørk buljong Fyldig kjøttbuljong med kraftig god smak Ideell til mørke sauser, supper, gryter og andre kjøttretter Toro Mørk Buljong er en ypperlig drikkebuljong TIPS:


Kyllingfilet med råkost Onsdag

Kyllingfilet med råkost Onsdag Kyllingfilet med råkost Onsdag Kyllingfilet med råkost er både sunt og svært raskt å tilberede. Middagen er ferdig servert på et kvarter INGREDIENSER 4 stk kyllingfilet 1 ss flytende margarin til steking


Kyllingfilet med poteter i tomatsaus Onsdag Det er hverdager det er flest av. Her er en god hverdagsmiddag med kyllingfilet som er ferdig på

Kyllingfilet med poteter i tomatsaus Onsdag Det er hverdager det er flest av. Her er en god hverdagsmiddag med kyllingfilet som er ferdig på Kyllingfilet med poteter i tomatsaus Onsdag Det er hverdager det er flest av. Her er en god hverdagsmiddag med kyllingfilet som er ferdig på 2 PORSJONER INGREDIENSER 4 stk kyllingfilet 1 ss margarin til


Strimlet svinekjøtt med asiatisk smak Onsdag MIN 4 PORSJONER

Strimlet svinekjøtt med asiatisk smak Onsdag MIN 4 PORSJONER Strimlet svinekjøtt med asiatisk smak Onsdag 20 40 MIN 4 PORSJONER INGREDIENSER 600 g renskåret svinekjøtt i strimler 2 ss margarin til steking 1 2 ts salt 1 4 ts pepper KÅL- OG KOKOSSALAT: 350 g hodekål


Kyllingwok med fullkornsnudler Onsdag

Kyllingwok med fullkornsnudler Onsdag Kyllingwok med fullkornsnudler Onsdag Kyllingwok med fullkornsnudler 600 g kyllingfilet 1 ss olje 1/2 ts salt 1/2 ts pepper 1 stk løk 2 stk gulrot 1/2 stk brokkoli 200 g hodekål 1 pk frisk babymais 1 stk


Snøfrisk. En ost med mange muligheter

Snøfrisk. En ost med mange muligheter Snøfrisk En ost med mange muligheter Snøfrisk er en serie med fersk kremost med myk smørbar konsistens. Snøfrisk er laget av 80 % geitemelk og 20 % kufløte. Smaken er frisk og syrlig med karakteristisk,


Bakt torsk med pasta Onsdag 4 porsjoner 40-60 min Enkelt

Bakt torsk med pasta Onsdag 4 porsjoner 40-60 min Enkelt Bakt torsk med pasta Onsdag 4 porsjoner 40-60 min Enkelt INGREDIENT LIST 800 g torskefilet, uten skinn og bein 1 dl salt, grovt 400 g farfalle pasta Saus 1 stk fennikel, frisk 1 stk løk 1 stk sjalottløk


Fiskegryte med grønnsaker

Fiskegryte med grønnsaker Fiskegryte med grønnsaker 4 porsjoner 20-40 min Enkelt 400 g torskefilet, uten skinn og bein 1 stk vårløk 2 stk gulrot 2 skiver kålrot 4 stk potet 2 dl vann 1 ss hvetemel 2 dl melk 0,5 terning fiskebuljong


Hellstrøms fiskegryte 15-30 min

Hellstrøms fiskegryte 15-30 min Hellstrøms fiskegryte 15-30 min 2 kg blåskjell 800 g valgfri fiskefilét 4 store poteter 1/2 loff 1 løk 4 fedd hvitløk 500 g tomater eller cherrytomater 1 kvist timian 1/4 ts kajennepepper 2 ss olivenolje


KYLLING I PITA Onsdag Enkel Under 20 min

KYLLING I PITA Onsdag Enkel Under 20 min KYLLING I PITA Onsdag Enkel Under 20 min INGREDIENSER 4 PORSJONER 4 stk kyllingfilet 2 ss olje til steking 1 stk gul paprika 1 stk rød paprika 4 stk vårløk 4 stk grove pitabrød 2 dl matyoghurt 4 stk salatblad





Pasta med laks Onsdag 4 porsjoner 20-40 min Enkelt

Pasta med laks Onsdag 4 porsjoner 20-40 min Enkelt Pasta med laks Onsdag 4 porsjoner 20-40 min Enkelt INGREDIENT LIST 600 g laksefilet, uten skinn og bein 4 pors pasta 3 dl matfløte 2 dl parmesanost 2 ss basilikum, frisk salt Tilbehør grønnsaker Framgangsmåte


1 Sett over vann til blomkål og sett ovnen på 200 grader. 2 Baconet strimles og stekes gyllent og sprøtt i stekepanne på litt over

1 Sett over vann til blomkål og sett ovnen på 200 grader. 2 Baconet strimles og stekes gyllent og sprøtt i stekepanne på litt over MIDDELS 30 MIN. B L O M K Å L O G A S PA R G E S S A L AT M E D K R U T O N G E R O G BAC O N 100 g bacon i strimler/biter 1 blomkål - i små buketter 6 grønne asparges skrelt og delt i staver 6 reddiker



TORSK TIL HVERDAG OG FEST TORSK TIL HVERDAG OG FEST TORSK Knapt noen fisk er så allsidig og så høyt verdsatt som den norske torsken. Den er perfekt til hverdagsretten der tiden er knapp, familien er sulten og du har behov for en


9 48 * 5 om dagen. Gulrotstaver med dipp. om dagen: om dagen: om dagen: om dagen:

9 48 * 5 om dagen. Gulrotstaver med dipp. om dagen: om dagen: om dagen: om dagen: 1 dl REMA 1000 appelsinjuice, 6,40 pr. l. 0 64 1 pære, 130 g kr 25,00 pr. kg 100 g gulrot kr 11,90 pr. kg 2 200 g REMA 1000 lapskausblanding og 120 g REMA 1000 pastasaus 3 25 1 19 4 40 Prisen inkluderer:


Skrell gulrøttene, og kutt de i grove biter. Finhakk hvitløken. Ha dette sammen med smøret i en gryte og surr dette på middels varme i noen minutter.

Skrell gulrøttene, og kutt de i grove biter. Finhakk hvitløken. Ha dette sammen med smøret i en gryte og surr dette på middels varme i noen minutter. VERDENS BESTE GULROTSUPPE Onsdag 10 økologiske gulrøtter 2 ss smør 2 fedd hvitløk 1 ss revet ingefær 4 dl kyllingbuljong (min er fra helsekosten) 4 dl fløte/melk 1/2 sitron 1 appelsin Skrell gulrøttene,


Forvarm ovnen til 180 grader. Legg blomkålen i en ildfast form. (Om du skal bruke rester av kylling eller skinke kan du legge det også i formen).

Forvarm ovnen til 180 grader. Legg blomkålen i en ildfast form. (Om du skal bruke rester av kylling eller skinke kan du legge det også i formen). Blomkålgrateng 30 min Dette trenger du til 4 porsjoner 1 kg blomkålbuketter 0,5 ts muskat 60 g gulost, revet 25 g smør 25 g hvetemel 3 dl melk salt og nykvernet pepper 2 ss griljermel Slik gjør du det:


BYGG- OG HVETERIS. Tilbered Bygg- og Hveteris Express i vannbad på 5 minutter eller i mikro en på 90 sekunder.

BYGG- OG HVETERIS. Tilbered Bygg- og Hveteris Express i vannbad på 5 minutter eller i mikro en på 90 sekunder. e n k e lt å t i l b e r e d e sunne og gode oppskrifter BYGG- OG HVETERIS Tilbered Bygg- og Hveteris Express i vannbad på 5 minutter eller i mikro en på 90 sekunder. finn flere oppskrifter på www.mollerens.no


Hellstrøms ovnsbakte torsk Onsdag

Hellstrøms ovnsbakte torsk Onsdag Hellstrøms ovnsbakte torsk Onsdag 15-30 min Ca.1400 gr torskefilet 2 brokkoli 2 squash 4 rødløk 8 fedd hvitløk Sherry tomater Olivenolje Salt og pepper 1. Del squash, brokkoli og løk i passende biter.


Till 2 l spansk kikertog chorizo-suppe

Till 2 l spansk kikertog chorizo-suppe spansk kikertog chorizo-suppe 40 ml olivenolje 150 g chorizo-pølse, finhakket 175 g løk, skrelt og finhakket 5 g hvitløk, skrelt og finhakket 50 g stangselleri, finhakket 100 g frisk spinat, vasket og


Grønn wok med cashewnøtter Onsdag

Grønn wok med cashewnøtter Onsdag Grønn wok med cashewnøtter Onsdag Ingredienser: 2 4 personer 1 liten/mellomstor brokkoli 100 g aspargesbønner 100 g renset grønnkål 50 g grovhakkede cashewnøtter 1 rød chili, renset for frø og finstrimlet


SUPPER OG GRYTER fra hele verden

SUPPER OG GRYTER fra hele verden Ferskt og salt kjøtt 04 05-08-04 15:03 Side 1 SUPPER OG GRYTER fra hele verden FERSKT OG SALT KJØTT I TERNINGER OG STRIMLER Ferskt og salt kjøtt 04 05-08-04 15:03 Side 2 FERSKT KJØTT Side GULASJSUPPE 4


Enkle hverdagsretter med laks

Enkle hverdagsretter med laks Enkle hverdagsretter med laks Hverdagsretter med laks Alle er sultne og ingen orker vente! Likevel kan du velge gode, sunne hverdagsmiddager. Dette oppskriftsheftet gir deg seks gode forslag. God middag!



FISKESUPPE FRÅ KALVÅG 2 PORSJONAR SUPPER FISKESUPPE FRÅ KALVÅG 2 PORSJONAR 100-200g Fiskebiter av torsk, sei og brosme* 300ml Fiskekraft ** 150ml Kvitvin ** 1 stk. Lauk 1/3 Kvitlauk 200ml Fløyte 30-50ml Olivenolje 1ss Sitronsaft 2-3 stk.


Lag deilige retter med egg!

Lag deilige retter med egg! Vær med på å feire Verdens eggdag fredag 10. oktober: Lag deilige retter med egg! Egg i hele verden Egg spises over hele verden, i alle kulturer, i fattige såvel som i rike land. Egget gir menneskekroppen


Enkle hverdagsretter med laks

Enkle hverdagsretter med laks Enkle hverdagsretter med laks Hverdagsretter med laks Alle er sultne og ingen orker å vente. Maten skal helst på bordet så fort som mulig. Da går mange for kjappe løsninger som gir lite næring. Tenk om



KYLLING MED FERSK PASTA Onsdag Enkel 20 40 min 4 PORSJONER KYLLING MED FERSK PASTA Onsdag Enkel 20 40 min 4 PORSJONER 4 stk kyllingfilet 2 stk gulrot 1 stk grønn squash Ostesaus: 2 ss smør 4 ss hvetemel ca. 6 dl melk ca. 2 dl revet hvitost 4 ss hakket frisk basilikum



OPPSKRIFTER PÅ TØRRFISK KLIPPFISK BOKNAFISK OPPSKRIFTERPÅTØRRFISK KLIPPFISK BOKNAFISK Accomodata En av de mest tradisjonsrike rettene fra Liguriaområdet, Genova. Dette er en gryterett på tørrfisk. Basert på 4 porsjoner 600 gram tørrfisk utvannet


Rask kyllingsalat Onsdag

Rask kyllingsalat Onsdag Rask kyllingsalat Onsdag Denne middagen har du alltid tid til... 15 min Dette trenger du til 2 porsjoner 0,5 stk kylling, ferdig stekt 150 g aspargesbønner 8 stk sukkererter 0,5 stk sellerirot 0,5 stk


ENKELT OG GODT. 7 retter du garantert lykkes med

ENKELT OG GODT. 7 retter du garantert lykkes med ENKELT OG GODT 7 retter du garantert lykkes med Foto: Studio Dreyer-Hensley OVNSBAKT LAKS MED SITRON GJØR DET ENKELT! Vi vet at mange har lyst til å spise mer fisk, men at de tror det er så vanskelig å


Spis fargerikt. Lun laksesalat med avokado og spinat

Spis fargerikt. Lun laksesalat med avokado og spinat Brokkoli, kål, rosenkål, grønn paprika, erter, Kiwi, spinat, asparges, pærer, grønne epler, salat. Lun laksesalat med avokado og spinat 300 g laksefilet i biter (gjerne Salma) 120 g spinat 80 g avocado



REKER 7 VELSMAKENDE RETTER REKER 7 VELSMAKENDE RETTER REKECOCKTAIL MED NY VRI REKER 2 skiver loff 2 hjertesalat ½ agurk mango 4 ss majones 2 ss soyasaus lime De norske rekene vokser opp dypt nede i kaldt, klart vann. Det er det



7 RASKE OG VELSMAKENDE SJØMATMIDDAGER RASK 7 RASKE OG VELSMAKENDE SJØMATMIDDAGER TORSKE- PANNE RASKE RETTER MED FISK! Vi vet at mange har lyst til å spise fisk oftere. Det er bare et hinder: man tror fisk betyr komplisert mat som tar lang


ENKELT OG GODT 7 retter du garantert lykkes med

ENKELT OG GODT 7 retter du garantert lykkes med ENKELT OG GODT 7 retter du garantert lykkes med Gjør det t! OVNSBAKT LAKS MED SITRON 600 g 2 ss 4 ss laksefilet uten skinn og bein soyasauce sitron 2 ½ vårløk grønt eple hjertesalat avokado Salat Vi vet


Strimlet svinekjøtt med asiatisk smak Onsdag

Strimlet svinekjøtt med asiatisk smak Onsdag Strimlet svinekjøtt med asiatisk smak Onsdag 20 40 MIN 4 PORSJONER INGREDIENSER 600 g renskåret svinekjøtt i strimler 2 ss margarin til steking 1 2 ts salt 1 4 ts pepper KÅL- OG KOKOSSALAT: 350 g hodekål


Oppskrifter. Lag knekkebrød med Fedon Musli. og sunne pastaretter med Fedon Fusilli

Oppskrifter. Lag knekkebrød med Fedon Musli. og sunne pastaretter med Fedon Fusilli Oppskrifter Lag knekkebrød med Fedon Musli og sunne pastaretter med Fedon Fusilli Knekkebrød med Fedon Musli 1 pose Fedon musli 3 ss mandler (kan droppes) 1 ts salt 1 ss økologisk kokosfett (kan droppes)


MULTI-COOKER -OPPSKRIFTER. Gå til kitchenaid.eu for flere oppskrifter

MULTI-COOKER -OPPSKRIFTER. Gå til kitchenaid.eu for flere oppskrifter MULTI-COOKER -OPPSKRIFTER Gå til kitchenaid.eu for flere oppskrifter FRANSK KYLLINGGRYTE 4 skiver bacon, grovhakket 2 kyllingpølser 1 ss olivenolje 35 g hvetemel saltflak og nykvernet sort pepper til å


Vandreleiren 2006 Primitiv kokebok

Vandreleiren 2006 Primitiv kokebok Vandreleiren 2006 Primitiv kokebok COWBOY BRØD...3 KRYDDERSMØR...4 BOLLER...5 GRØNNSAKER I WOK...6 INNBAKT PIZZA...7 EPLEKAKE...9 FYLTE PANNEKAKER...11 STEKT LAKS...14 COWBOY BRØD Ca 5 dl mel ½ ss bakepulver


Tid for SKREI! 5 smakfulle oppskrifter

Tid for SKREI! 5 smakfulle oppskrifter Tid for SKREI! 5 smakfulle oppskrifter Tradisjonell skreimølje ca. 1 kg fersk skrei/torsk i skiver 1 dl salt 2 l vann hel svart pepper Rogn 1 rogn av skrei/torsk, ca. 400 g 1 l vann 2 ss salt Lever ca.


Ølbrasiert Lammeskank

Ølbrasiert Lammeskank Ølbrasiert Lammeskank Ølbrasiert lammeskank 2 ss olivenolje 4 stk Gilde Polarlam lammeskank 1 stk hakket løk 1 stk stilkselleri (stangselleri) 2 finhakket hvitløksfedd 3 dl øl (alkoholfritt kan godt brukes)


Wonderbag oppskrifter

Wonderbag oppskrifter Wonderbag oppskrifter Wonderbag er en isolert slowcooker bag som ikke bruker strøm, som gjør det mulig å la maten koke videre etter at gryten er tatt av varmekilden. Wonderbag hjelper deg med å spare tid,


Grønnsakssuppe Onsdag

Grønnsakssuppe Onsdag Grønnsakssuppe Onsdag Denne enkle, men veldig gode suppen lager du på 1 2 3. En hverdagsoppskrift både barn og voksne setter pris på. Vanskelig? Enkel Tid 20 min TIPS: Suppen er like god uten pølser, dersom


Et utvalg oppskrifter fra Barnehagegården

Et utvalg oppskrifter fra Barnehagegården Et utvalg oppskrifter fra Barnehagegården Foto: Line Cecilie Grefslie Her finner du oppskrift på: Oppskrifter og foto er fra Fru Timian og matprat.no Thaigryte med strimlet svinekjøtt Arvekylling Lettvint


Stekt laks med pæresalat Onsdag

Stekt laks med pæresalat Onsdag Stekt laks med pæresalat Onsdag 4 porsjoner 20 min Enkelt 700 g laksefilet, uten skinn og bein 4 ss hvetemel 0,5 ts salt 0,5 ts pepper 4 stk pære 2 dl crème fraîche, lett Tilbehør potet Del laksen i stykker,


Grønnsaksuppe Onsdag. Per porsjon: 165 kcal En god suppe som varmer når høsten kommer og det begynner å bli kaldt. Sunn og god.

Grønnsaksuppe Onsdag. Per porsjon: 165 kcal En god suppe som varmer når høsten kommer og det begynner å bli kaldt. Sunn og god. Grønnsaksuppe Onsdag Per porsjon: 165 kcal En god suppe som varmer når høsten kommer og det begynner å bli kaldt. Sunn og god. Grønnsaksuppe 100 g byggryn, tørre 250 g gulrot 250 g kålrot 2 stk løk 1 stk


Fullkornspasta med kjøttdeig og tomatsaus

Fullkornspasta med kjøttdeig og tomatsaus Fullkornspasta med kjøttdeig og tomatsaus 2 pk. kjøttdeig (á 400 g), velg enten karbonade-, kylling- eller svinekjøttdeig 1 pk. fullkornspasta 4 små løk, finhakket 4 fedd hvitløk, finhakket 2 boks hakkede


Inspirasjon til Bra Mat. for deg med diabetes 2, hjerte- karsykdommer, KOLS

Inspirasjon til Bra Mat. for deg med diabetes 2, hjerte- karsykdommer, KOLS Inspirasjon til Bra Mat for deg med diabetes 2, hjerte- karsykdommer, KOLS INNHOLD Bakt laks med soya, ingefær og chili Bakt torsk med soya, ingefær og chili Ratatouille Rotmos Byggris Salat Havre- og


Makrell. enkle retter med en smak av sommer

Makrell. enkle retter med en smak av sommer Makrell enkle retter med en smak av sommer Grillet lettgravet makrell Lyse sommernetter, blikkstille hav og gode venners lag har en smak, og det er smaken av grillet makrell. Makrellen tilbringer vinteren


Oppskrifter på garantert gode pølser

Oppskrifter på garantert gode pølser Det er mye kjøtt i de beste pølsene Foto: H2W, Dreyer/Hensley Styling: Nina Sjøen, Paul Løwe Oppskrifter på garantert gode pølser www.gilde.no Garantert gode pølser De beste pølsene er de som er garantert


ekte italiensk kjærlighet

ekte italiensk kjærlighet Gi hverdagen et lite dryss av ekte italiensk kjærlighet Den italienske kjærligheten. Du kjenner den når du lar en bit Reggiano smelte på tungen. Gjennom flere års lagring modnes osten og smaken kan fortone


Ovnsbakt dill- og tomatlaks med bulgur

Ovnsbakt dill- og tomatlaks med bulgur Ovnsbakt dill- og tomatlaks med bulgur 2 dl Nutridrink Protein aprikos 1 dl kremfløte 1 ss konsentrert skalldyrkraft 2 ss tomatpuré 1 ts sambal oelek 2 ts konsentrert sitronsaft på flaske eller fra fersk


4 PORSJONER. INGREDIENSER 4 stk kyllingfilet, à 120 g 1 2 ts salt 1 2 ts pepper 2 ss margarin til steking

4 PORSJONER. INGREDIENSER 4 stk kyllingfilet, à 120 g 1 2 ts salt 1 2 ts pepper 2 ss margarin til steking Kyllingfilet med rotgrønnsaker og fetaost Onsdag 20 40 MIN Saftig, norsk kyllingfilet på sitt beste, servert med salat av gode rotgrønnsaker. Det slår aldri 4 PORSJONER INGREDIENSER 4 stk kyllingfilet,



MER KJØTT MER GLEDE MED KJØTTRIKE PØLSER MER KJØTT MER GLEDE MED KJØTTRIKE PØLSER SMAKSRIKE TRADISJONER God smak gir mersmak. Våre pølser bygger på årelange tradisjoner innen foredling av kjøtt, og vi benytter kun de beste norske råvarer av aller


Tortilla med laks Onsdag UNDER 20 MIN 2 PORSJONER

Tortilla med laks Onsdag UNDER 20 MIN 2 PORSJONER Tortilla med laks Onsdag UNDER 20 MIN 2 PORSJONER 200 g potet i terninger 1 ss olje 1 ss grovhakket løk 4 stk egg 2 ss vann 2 ss bladpersille 1 ss finhakket tørket dill 1 ss hakket tørket gressløk 3 ss



ET HAV AV MULIGHETER ET HAV AV MULIGHETER meny Marinert laks à la Gastronomisk Institutt 500 g laksefilet Marinade 500 g sukker 490 g salt 1dl sake Pepperblanding 30 g sort helpepper 20 g hvit helpepper ristes i varm panne


Kyllingfilet med gratinerte rotfrukter Onsdag 20 40 MIN 4 PORSJONER

Kyllingfilet med gratinerte rotfrukter Onsdag 20 40 MIN 4 PORSJONER Kyllingfilet med gratinerte rotfrukter Onsdag 20 40 MIN 4 PORSJONER INGREDIENSER 4 stk kyllingfilet 2 ss flytende margarin 3 stk gulrot 2 stk persillerot 2 skive sellerirot 100 g revet parmesan 1 ts tørket


Følgende menyer er forslag til måltider du kan lage 7 til 2 dager før undersøkelsen.

Følgende menyer er forslag til måltider du kan lage 7 til 2 dager før undersøkelsen. Følgende menyer er forslag til måltider du kan lage 7 til 2 dager før undersøkelsen. Uken før behandling med tarmtømmingsmiddel bør du spise lettfordøyelig mat. Du bør unngå fullkorn og frø, tungt fordøyelige


Julemiddager som imponerer. uten stress

Julemiddager som imponerer. uten stress Julemiddager som imponerer uten stress Julelaks med pepperrotkrem og frisk salat Tid til å være sammen Alle middager trenger ikke være så vanskelige. Du får en perfekt laks i stekeovnen, en delikat rett


Kylling suppe. Squash n steak 1 butternut squash, uten skall/frø i biter Høyrygg i biter Buljong eller vann

Kylling suppe. Squash n steak 1 butternut squash, uten skall/frø i biter Høyrygg i biter Buljong eller vann Kylling suppe 1 stor gryte fylles med 1/3 kylling, 1/3 gulrot, et par stilker selleri + 2 løk. La alt koke i ca 4 timer. Ta ut kyllingen og ta vekk bena og skinnet. Ta ut alle grønnsakene og sil kraften.


2 blomkålhoder Vann 3 dl Fløte Kyllingbuljongterning 1-2 fedd hvitløk finhakket løk (gjerne charlottløk) Smør Hakket vårløk Salt og pepper

2 blomkålhoder Vann 3 dl Fløte Kyllingbuljongterning 1-2 fedd hvitløk finhakket løk (gjerne charlottløk) Smør Hakket vårløk Salt og pepper Blomkålsuppe 2 blomkålhoder Vann 3 dl Fløte Kyllingbuljongterning 1-2 fedd hvitløk finhakket løk (gjerne charlottløk) Smør Hakket vårløk Salt og pepper Onsdag Sånn gjør du det: 1. Stek hakket løk og hvitløk


Sånn gjør du: Tilbered produktet i ovn i GN bakk. Kok basmatiris. Til 10 personer trenger du:

Sånn gjør du: Tilbered produktet i ovn i GN bakk. Kok basmatiris. Til 10 personer trenger du: Tilbered produktet i ovn i GN bakk. Kok basmatiris 2500 g Findus Seigryte Créative m/mango og bønner i tomat-/kokossaus 650 g ris 1 ts salt Muligheter tilberedning: Tilberedningstider og temperaturer varierer


Lag mat med Mille. Muffins med hvit sjokolade og mais. Sånn gjør du: Det skal du bruke: (ca. 9-10 muffins)

Lag mat med Mille. Muffins med hvit sjokolade og mais. Sånn gjør du: Det skal du bruke: (ca. 9-10 muffins) Muffins med hvit sjokolade og mais (ca. 9-10 muffins) 75 g smør 75 g sukker 2 egg 1 dl yoghurt, f.eks. gresk yoghurt Revet appelsinskall fra 1 appelsin (godt vasket) 180 g hvetemel 1½ ts bakepulver 50


Stekt laks med ruccolacouscous Onsdag Send meg tips! Per porsjon: 432 kcal Laks med smakfull marinade og spennende tilbehør.

Stekt laks med ruccolacouscous Onsdag Send meg tips! Per porsjon: 432 kcal Laks med smakfull marinade og spennende tilbehør. Stekt laks med ruccolacouscous Onsdag Send meg tips! Per porsjon: 432 kcal Laks med smakfull marinade og spennende tilbehør. Stekt laks 600 g laksefilet 1 ss olje 1 dl tabasco Garlic Skjær laksefileten


Geitmyra juniorkokk Fisk fra nord og sør

Geitmyra juniorkokk Fisk fra nord og sør Geitmyra juniorkokk Fisk fra nord og sør Et kurs ved Geitmyra matkultursenter for barn med Mai Linn Muskaug Kursrekken er gjennomført med støtte av Eckbos Legater CEVICHE Ceviche er en rett fra Sør-



SMAKFULLE oppskrifter MED PHILADELPHIA LIGHT SMAKFULLE oppskrifter MED PHILADELPHIA LIGHT HVITLØK & Urter Philadelphia elsker all mat sk pp riftene er 10 ti l O P o rsjone r Philadelphia er en mild kremost som passer til både varm og kald mat. Den


Oppskrifter nytta til koking av middag på bål til over 100 personar Idrettskonferansen 2015 i anledning Friluftslivets år: NATUREN SOM LÆRINGSARENA

Oppskrifter nytta til koking av middag på bål til over 100 personar Idrettskonferansen 2015 i anledning Friluftslivets år: NATUREN SOM LÆRINGSARENA Oppskrifter nytta til koking av middag på bål til over 100 personar Idrettskonferansen 2015 i anledning Friluftslivets år: NATUREN SOM LÆRINGSARENA Gruppe 1 Stavangersuppe med currypaste til 12-14 personer



KRABBE 7 ENKLE RETTER DU VIL LYKKES MED KRABBE 7 ENKLE RETTER DU VIL LYKKES MED TASKE- KRABBE Taskekrabben er den vanligste krabben langs norskekysten, og kalles gjerne bare krabbe. Krabben bruker lang tid på å vokse i det kalde klare vannet.


godt, sunt, enkelt og raskt

godt, sunt, enkelt og raskt meny2001 1,6 kg blåskjell 200 gr usaltet smør 1 fedd hvitløk 10 stk soltørket tomat (evt 1 frisk tomat) 2 stk sjalottløk 1 skive spekeskinke 10 blader basilikum 2 ss tomatpuré 1/2 ts salt 1/4 ts pepper


Geitmyra juniorkokk Lam fra sør og nord

Geitmyra juniorkokk Lam fra sør og nord Geitmyra juniorkokk Lam fra sør og nord Et kurs ved Geitmyra matkultursenter med Hans Edvard Reppen Høsten 2015 Kursrekken er gjennomført med støtte av Eckbos Legater Lammeboller Høst er sessong for lam,


Wok med økologisk kjekjøtt

Wok med økologisk kjekjøtt Wok med økologisk kjekjøtt 600g økologisk kjekjøtt 50g økologisk rød paprika 100g økologisk brokkoli 100g økologiske gulrøtter 100g økologisk purre eventuelt 4 vårløker 1 økologisk rødløk 3ss rapsolje



GULROTSUPPE MED APPELSIN OG INGEFÆR Onsdag GULROTSUPPE MED APPELSIN OG INGEFÆR Onsdag Til 3-4 porsjoner trenger du omtrent: 700 g (økologiske) gulrøtter, i biter 1 løk, grovt hakket 4 hvitløkfedd, finhakket 1/2-1 rød chili, finhakket 20 g ingefær,


Smak & Eleganse. oksesjysaus kyllingsjysaus svinesjysaus

Smak & Eleganse. oksesjysaus kyllingsjysaus svinesjysaus Smak & Eleganse oksesjysaus kyllingsjysaus svinesjysaus Kyllinglår med ris og ratatuolli 10 stk kyllinglår TORO Parboild Ris 65 g TORO kyllingsjysaus pastøs 1 l vann olivenolje 1 stk squash 1 stk aubergine



NYHETER SEPTEMBER 2013 N 03 2013 NYHETER SEPTEMBER 2013 N 03 2013 September Nyheter! Her finner du alle våre spennende nyheter i september. Vi håper du lar deg friste til å prøve nyhetene våre som vi tror både dere på kjøkkenet og spisegjestene


Før mors kjøttkaker nå dine

Før mors kjøttkaker nå dine Før mors kjøttkaker nå dine 8 raske middager Nye tider like gode kjøttkaker Ingenting er som mors kjøttkaker men nå er det på tide å ta over og det tar bare et par minutter. Legg Gilde Karbonader, Gilde


liker best som paprika, løk, sopp, squash, mais. Wook med ulike grønnsaker, skinke og ris er også godt.

liker best som paprika, løk, sopp, squash, mais. Wook med ulike grønnsaker, skinke og ris er også godt. Dette er et lite hefte fra maten vi lager når vi er på tur. Disse oppskriftene er henta fra boka «Liv og røre, matopplevelser i friluft» av Reidun Høines. Det finnes mange gode oppskrifter og tips i denne


Torsk på nye måter SEKS raske OPPSKrIFTEr

Torsk på nye måter SEKS raske OPPSKrIFTEr Torsk på nye måter SEKS raske OPPSKRIFTER Kirkenes de luxe! CORNFLAKES-STEKTE TORSKENUGGETS Dette trenger du til 4 porsjoner. 600 g torskefilet uten skinn og bein 2 stk egg 2 ss søt chilisaus 4 dl Cornflakes


Skap påskestemning med sild!

Skap påskestemning med sild! Skap påskestemning med sild! Koriander og ingefærsild 5 eddikmarinerte sildefileter 4 dl vann 3,5 dl sukker 2 dl eddik, 7 % 1 rødløk i skiver 50 g frisk ingefær 1 ss korianderfrø 1 bunt frisk koriander



DU TRENGER: PINNEKJØTT, KÅLROT, GULROT, POTET, VANN, SALT, PEPPER, KREMFLØTE, SMØR, VOSSAKORV OG PINNER Ukesmeny - uke 52 Julaften Onsdag Deres tradisjonsrike julemiddag Pinnekjøtt Torsdag Pinnekjøtt med rotmos OVER 60 MIN 5 PORSJONER INGREDIENSER 2 kg pinnekjøtt, gjerne mer til et sultent lag! ROTMOS: 11


Skap påskestemning med sild!

Skap påskestemning med sild! Skap påskestemning med sild! Koriander og ingefærsild 5 stk eddikmarinerte sildefileter 2 dl eddik, 7 % 4 dl vann 3 1/2 dl sukker 2 ss eplecidereddik 1 ts brunt sukker 1 dl olivenolje 1 stk rødløk i skiver


Saftig, mørnet kvalitetslam fra det norske høyfjellet!

Saftig, mørnet kvalitetslam fra det norske høyfjellet! Saftig, mørnet Hentet i høyfjellet Gourmetlam Hallingskarvet er saftig og mørnet kvalitetskjøtt fra lam som har beitet i fjelltraktene omkring Hardangervidda. Hallingskarvet er et kjent og kjært landemerke


Redskap 1.1. Gryter og panner. Et godt kjøkken har mange redskaper, og alle redskaper har sine spesielle funksjoner.

Redskap 1.1. Gryter og panner. Et godt kjøkken har mange redskaper, og alle redskaper har sine spesielle funksjoner. 1. Basiskunnskap Det grunnleggende Redskap Et godt kjøkken har mange redskaper, og alle redskaper har sine spesielle funksjoner. Gryter og panner Bruk gryter som er laget av aluminium, jern eller titan.


Opplysningskontorene i Landbruket Landbruks og Matdepartementet

Opplysningskontorene i Landbruket Landbruks og Matdepartementet Oppskriftshefte for PoppOpp restauranten 1/11 2010 Opplysningskontorene i Landbruket Landbruks og Matdepartementet Aperitiff: Syrlig blå smoothie Oppskriften gir ca 10 glass Ingredienser: 2 dl eple juice


Nå er Danmarks mest solgte frossensuppe endelig i Norge! VINN. PARTY-kasseroller SE PÅ BAKSIDEN OPPSKRIFTER MED FERDIG SUPPE

Nå er Danmarks mest solgte frossensuppe endelig i Norge! VINN. PARTY-kasseroller SE PÅ BAKSIDEN OPPSKRIFTER MED FERDIG SUPPE Nå er Danmarks mest solgte frossensuppe endelig i Norge! VINN PARTY-kasseroller SE PÅ BAKSIDEN OPPSKRIFTER MED FERDIG SUPPE En god suppe skal tilberedes med stor tålmodighet. Men ikke tilfeldigvis din.


Makrell enkle retter med en smak av sommer

Makrell enkle retter med en smak av sommer Makrell enkle retter med en smak av sommer Lyse sommernetter, blikkstille hav og gode venners lag har en smak, og det er smaken av grillet makrell. Makrellen tilbringer vinteren på dypt vann utenfor Sørvest-Norge,


Konsept fra Gilde og ASKO. Inspirasjon til julemenyen!

Konsept fra Gilde og ASKO. Inspirasjon til julemenyen! Konsept fra Gilde og ASKO Inspirasjon til julemenyen! Svin indrefilet Med St. Kristina skinke og salvie Knud Kjetland Kokk, Saftig, godt - og alltid mørt! Svineribbe er jo en selvfølge på julemenyen, men


ANTIPASTI. Til å ta med & nyte. Italienske forretter du kan lage selv. marche-restaurants.com

ANTIPASTI. Til å ta med & nyte. Italienske forretter du kan lage selv. marche-restaurants.com ANTIPASTI Italienske forretter du kan lage selv Til å ta med & nyte marche-restaurants.com (Fylte sjampinjonger) Funghi ripieni 200 g store sjampinjonger, brune eller hvite 10 g bladpersille 1 egg 25 g


Ukemeny Uke 1. Kalkun med den klassiske waldorfsalaten

Ukemeny Uke 1. Kalkun med den klassiske waldorfsalaten Ukemeny Uke 1 Nyttårsaften Onsdag Kalkun med den klassiske waldrfsalaten PORSJONER 8 INGREDIENSER ca. 13 5 kg kalkunfilet 2 ss smør 1 2 ts salt 1 4 ts pepper WALDORFSALAT: 5 stk eple 1 stk stilkselleri


STEKT FLESK MED DUPPE EKSPRESSMENY. og rotmos. Poteter: Flesk: BASISVARER: Salt, pepper, solsikke-/rapsolje, smør.

STEKT FLESK MED DUPPE EKSPRESSMENY. og rotmos. Poteter: Flesk: BASISVARER: Salt, pepper, solsikke-/rapsolje, smør. Tips: Hell av stekfettet mellom hver gang du steker. Husk å ta vare på fettet, det skal i den hvite sausen. Om du har mulighet, kan du bruke to stekepanner samtidig, da går det raskere. Middels STEKT FLESK



OPPSKRIFTER OG INSPIRASJON OPPSKRIFTER OG INSPIRASJON Epd nr: 378729 Enkel å tilberede Utmerket kvalitet Smaker fantastisk Mangfoldige bruksområder Kostnadseffektivt 1 2 3 4 TILBEREDNING 10 porsjoner Mål opp 5dl Ebly 2 liter vann


Suppe er godt, næringsrikt og billig.

Suppe er godt, næringsrikt og billig. - 1 Hei Vi i prosjektgruppa ønsket oss økologisk møtemat, men det var ikke alltid lett å få tak i. Det gjorde at vi tok initiativ til å lage dette hefte med økologiske supper. Suppe er godt, næringsrikt



150 OPPSKRIFTER FRA NESTLÉ Oppskrift 17-24 150 OPPSKRIFTER FRA NESTLÉ 17. OVNSBAKT PASTA MED VEGETARFARSE, GRESSKAR OG CHÈVRE 175 g farse fra Hälsans Kök 750 g gresskar, i terninger Olivenolje salt, pepper 300 g rigatoni eller penne-pasta
