EVIDENSBASERING snart også i skolen?

Størrelse: px
Begynne med side:

Download "EVIDENSBASERING snart også i skolen?"


1 EVIDENSBASERING snartogsåiskolen? Enforskningsrapporttil NordicResearchCouncilforSteinerEducation TrondSkaftnesmo RudolfSteinerhøyskolen Oslo2011

2 Copyright 2011byTrondSkaftnesmo Allrightsreserved 2

3 INNHOLD PROLOG...5 DEL1:EVIDENSBEVEGELSEN...7 KAPITTEL1:IDEENOMEVIDENSBASERTKUNNSKAP...8 Dennyetidsmedisin...8 Enkorthistorikk...11 Hvamenesmedevidensbasering?...13 Evidenshierarkiet...16 Hvasomvirker...20 KAPITTEL2:FRAKUNNSKAPTILPRAKSIS...24 EBKversusEBP...24 Skjønnversusinstruks...25 DEL2:ETVITENSKAPSHISTORISKOGFILOSOFISKBAKTEPPE...29 KAPITTEL3:FRASUBJEKTTILOBJEKT...30 Kontekstogkausalitet...30 Detokulturer...34 Positivismeogkonstruktivisme...35 Positivismestriden...38 Figurering...41 Togrøfterogveienmellom...43 KAPITTEL4:VEIENTILVERDEN...48 Denkartesianskeøksen...48 Overlevelsesstrategier...50 Ågjøreverdenheligjen...51 KAPITTEL5:EVIDENSBASERINGIETVITENSKAPSFILOSOFISKLYS...56 Evidenspositivismen...56 Empiriskevidens...57 Dennyeeminensen...61 Evidentnytale...64 DEL3:EBPISKOLEOGSAMFUNN...69 KAPITTEL6:EVIDENSBASERINGOGSAMFUNN...70 Scientificmanagement...70 NewPublicManagement...71 Detsosialbyråkratiskesamfunn...72 Ghostmanagement...74 Evidensbasertmanagement

4 KAPITTEL7:EVIDENSBASERTSKOLE?...84 Utredningerogdebatt...84 Lærereffekten...87 Virkerforhva?...90 Erogbør...94 Virkerforhvem?...95 Skolensmenneskebilde...97 Detinstrumentalistiskemistaket Denmeningssøkendelæreren Hvordantalivetavetfag Åsedetstørremønsteret KAPITTEL8:EVIDENSBASERINGOGSTEINERSKOLE Enskoleforhelemennesket Enevidensbasertundervisningskunst? Forskningogpraksis Hvaeralternativet? SAMMENDRAGOGKONKLUSJON LITTERATUR

5 Prolog Hvorforskriveenrapportomevidensbaseringiskolen,etsystemsomikkeerinnførti noenordisklandogenproblemstillingsomfåskolefolk(ihvertfallinorge)vetnoeom? Detfinnesfleresvarpådetspørsmålet.Detførsteogmestopplagtesvareteratsystemet er under forberedelse og etter alle solemerker vil gjøre seg gjeldende i løpet av få år, ogsåiskolen.innenforhelsesektorenerdetaltinnført,omennikketilfullkommenhet. OgservitilerfaringenefraUSAogEU,vilsystemetrasktbreseguttilandreprofesjoner. Isåfallerdetbedreåtadebattenpåforskuddennpåetterskudd. Evidensbasering er et system som angår så vel teoretiske som praktiske, politiske og etiskespørsmål.historiskhardetsittutspringimedisinen.ogsidenmedisinoghelseså langterdenenestesektoreninordiskelanddersystemettilenvissgradertattibruk, sier det seg selv at vi må hente mange opplysninger og erfaringer fra dette feltet. Det somskjerihelsesektorenvilselvsagtikkegjentasegheltliktiutdanningssektoren.men destoreogprinsipiellespørsmålene,vilvesentligværedesamme:spørsmålomkvalitet ogkvalitetssikring,effektivitet,fagligekspertiseogskjønn,forskningogpraksis,kontroll og innsyn, brukermedvirkning og demokrati, osv. Dette er sentrale aspekter ved alle profesjoner,sompåulikevisvilbliberørtogtildelsendretavenevidensbasertpraksis. Rapportenerfinansiertavogutarbeidetpåoppdragfraforskningsorganisasjonenforde nordiske Steinerskolene; Nordic Research Council for Steiner Education. Arbeidet med rapportenvarendelavmittengasjementvedrudolfsteinerhøyskolenioslo,våren2011. Bådeoppdragsgiversinteresserogminegen25årsfartstidisteinerskolen,borgerforat problemstillingenevidensbaseringogsteinerskoleogsåbørblibehandlet.detteutgjørda rapportens siste hovedkapittel. De øvrige delene er skrevet med tanke på at de skal være aktuelle for alle skolefolk, eller for så vidt alle profesjonsutøvere eller studenter som vil ha et innblikk i emnet. Siden debatten om evidensbasering så langt har rukket lite ut over helsesektoren, er det grunn til å anta varierende forhåndskunnskaper hos potensielle lesere. Rapporten tar hensyn til dette ved å begynne med en historisk og idémessiginnføringiemnet. Despørsmålrapportenvildrøfte,oginoengradforsøkeråsvarepå,er: Hvamenesmedenevidensbasertkunnskap&praksis? Hvaerbakgrunnenfordenkraftigevekstenievidensbevegelsenidesiste20årene? Hvaharvært(oger)argumenteneforåimplementeredeniulikesektorer? Hvilkeendringsprosesser iskoleogsamfunn vilenevidensbasertpraksisutløse? Hvordanbørvistilleosstilogmøteenslikmuligutvikling? 5

6 Idenpolarisertedebattenomevidensbasering,erdetfortgjortåtaetstandpunkt for eller imot, før en riktig kjenner det fenomenet en skal mene noe om. Vil vi imidlertid forståevidensbevegelsensometkulturhistoriskfenomen,kanviikkebegrenseosstilå sepådettefenomenetforseg,innenforsineegnedefinertegrenser.vimåogsåkartlegge dets idémessige og historiske omgivelser. Et mål for denne rapporten er derfor å se evidensbevegelsen i lys av en større kulturhistorisk kontekst, noe som gir et bedre utgangspunktforennyansertdebatt. Del1presentererevidensbevegelsen,medvektpådensnærehistorieogsentraleideer. Demestkjentestridsspørsmålskisseresoppalleredeher,menennåuteneninngående drøfting.del2førerossinnidenvitenskapsfilosofiskeogidéhistoriskekontekstenfor evidensbevegelsen,medvektpåskismaetmellom detokulturer.dettedanneretviktig grunnlag for drøftingen i del 3, der evidensproblematikken først ses inn iet større samfunnsmessigperspektiv,dernestirelasjontilskolen.idetavsluttendekapitlet,om evidensbaseringogsteinerskolen,spissespåmangemåterdenforutgåendedrøftingen. Herskisseresogsåsentraledragveddennepedagogikken,myntetpådeleseresomikke påforhåndkjennerdensgrunntrekk. JegtakkerRudolfSteinerhøyskolenogNRCformulighetentilåarbeidemeddetteemnet over lengre tid. Det har vært både personlig og faglig givende å fordype seg i denne viktige problematikken. Jeg håper at denne entusiasmen også har nedfelt seg i teksten ogatinteressenvilsmitteoverpåleseren. Haugesund TrondSkaftnesmo Noensentraleakronymerogsynonymerbruktirapporten. EB EBK EBP EBM EBE RCT USDE Evidensbasert Evidensbasertkunnskap pånorskogsåkaltforskningsbasertkunnskap Evidensbasertpraksis pånorskogsåkaltkunnskapsbasertpraksis Evidensbasertmedisin Evidence basededucation(evidensbasertutdannelse) RandomizedControlledTrials,dvs.randomiserteforsøkmedkontroll U.S.DepartmentofEducation 6

7 Del1:Evidensbevegelsen 7

8 Kapittel1:Ideenomevidensbasertkunnskap Dennyetidsmedisin Den 4. november 1992 publiserte The Journal of the American Medical Association et manifest,somerklærtefødselenavetnyttmedisinskparadigme:evidensbasertmedisin. Manifestetåpnetslik: Etnyttparadigmeformedisinskpraksiserunderdannelse.Evidensbasertmedisin legger mindre vekt på intuisjon, usystematisk klinisk erfaring og patofysiologiens rasjonale[medisinsk lærebokskunnskap] som tilfredsstillende grunnlag for å fatte kliniske beslutninger. Det vektlegger studium av evidens fra klinisk forskning. Evidensbasert medisin krever nye ferdigheter av legen, inkludert effektivt litteratursøk, og bruken av formale regler for evidens i evalueringen av klinisk litteratur. Manifestetvarforfattetavenarbeidsgruppe Evidence BasedMedicineWorkingGroup medbasisidepartmentofclinicalepidemiologyandbiostatistics,mcmasteruniversity, Canada.Hvadesåforsegsomdeumiddelbarefølgeneavdetnyeparadigmet,kommer poengtert til uttrykk gjennom en innledende fortelling, der en tenkt klinisk situasjon skisseresopp.enturnuslegepåenklinikkfårinnen43 årigmannligpasient,somnylig har hatt et bevitnet epileptisk anfall (grand mal). Han har aldri hatt dette før. Han drikker alkohol 1 2 ganger i uken, men hadde ikke inntatt noe på dagen for anfallet. Pasienten får en standard behandling med phenytoin, først intravenøst og senere i pilleform. Verken EEG eller CT scanning avslører noe unormalt. Pasienten er svært bekymretangåenderisikoenforetnyttanfall.spørsmåleter:hvordanskalturnuslegen gåvidere? Herskisseresnåtoscenarier.Først,måtendetførblegjortpå:Turnuslegenblirfortalt aveneldrekollegaatrisikoenerhøy,menutenatdennekanangieteksaktprosenttall. Dette videreformidles til pasienten, som også får beskjed om ikke å kjøre bil, om å fortsettemedisineringenogellersoppsøkefastlegensomoppfølging.pasientenforlater klinikkenmedenvagfryktangåenderisikoenforetpåfølgendeanfall. Så, fremtidens måte: Turnuslegen spør seg selv om hun vet noe om prognosen etter et første anfall, og innser at det vet hun ikke. Hun går så inn på et on line bibliotek for medisinsk forskning (Grateful Med) og gjennomfører et litteratursøk. Hun finner 25 referansertilaktuelleforskningsartikler.vedåserasktovertitlene,finnerhundensom ser ut til å være mest relevant. Hun skumleser artikkelen, og får bekreftet at den tilfredsstiller de kriteriene hun har lært gjelder for en valid studie av prognoser og at resultatene kan appliseres på hennes pasient. Søket og lesningen har alt i alt tatt en halvtime. 8

9 Resultateneviseratpasientensrisikoforetnyttanfalldetførsteåretermellom30%og 43%,mensdenermellom51%og60%fordeførste3årene.Etterenanfallsfriperiode på 18 måneder vil risikoen for tilbakefall trolig være under 20%. Hun videreformidler denne informasjonen til pasienten, med en anbefaling om å fortsette medisineringen, samt, hvis han forblir anfallsfri i de kommende 18 måneder, oppsøke fastlegen og få vurdert behovet for en fortsatt medisinering. Pasienten forlater klinikken med en klar idéomprognosen. Tilfelleterkonstruert,mendetillustrererlikevelgodthvordanenforventetatdennye metoden skulle løfte medisinen opp til en ny høyde. Hva som her er illustrert for en prognose,vilgjeldetilvarendefordiagnoser,testerellerterapier.idetkonkretetilfellet kunneenselvsagtspørresegomdeeksakteprosenttallenevillegipasientensinnsro,om hanvirkeligerbedrestiltvedåfåviteatrisikoenfortilbakefalleropptil60%fremforat dener høy?kunnedenekstrahalvtimenværtanvendtbedre,f.eks.vedåsamtalemed pasienten?enkanogsåspørresegomdennefremgangsmåtenvirkeligvileffektivisere legensarbeid,omhunmåbrukelikelangtidpålitteratursøkforhvernypasienthunfår inn.mensidenhistorieneroppdiktet,blirslikespørsmålselvsagthengendeiløseluften. Manifestetunderstrekervidereatdennyemetodenkreverskolering.Dettegjelderikke bareselvelitteratursøket(i1992vardatasøkennånoksåeksotisk),menfremforaltfor å kunne foreta a rigorous methodological review of the available evidence hvilket betyrågjøreenvurderingavforskningens evidensverdi,ettereksaktangittekriterier. Uten at manifestet går nøye inn på de rigorøse kriteriene, anføres randomiserte kontrollforsøk(rct)somengullstandard.dessutenfremhevesstatistiskoppsummering (meta analyser) av flere slike forsøk. Dermed var hjørnesteinen lagt ned for det som snartskulleblikjentverdenoversomevidensbasertmedisin. De innledende setningene om at det heretter skulle legges mindre vekt på intuisjon, usystematisk klinisk erfaring og patofysiologiens rasjonale, kunne av mange leger bli oppfattetsomenkrigserklæringmotdenmedisinskeerfaringenogekspertisen.somfor åforebyggeenslikreaksjon(somdaogsåkom)understrekesdetsenere(s.4)at klinisk erfaringogutviklingenavkliniskeinstinkter(særligmht.diagnoser),eravgjørendeog nødvendigedeleravdetåblienkompetentlege.mangeaspekteravkliniskpraksiskan aldri,ellervilaldri,bliadekvattestet. Detteutsagnetfølgesimidlertidstraksoppaven advarselmotåstolepåegnekliniskeinnsikteroginstinkter.detfremhevesat: Imangel av systematiske observasjoner må en være forsiktig med tolkningen av informasjon fremkommetvedkliniskerfaringogintuisjon,fordekannoengangerværemisledende. Advarselengirbaremeningiforholdtilenkunnskapskildesomikke noenganger(kan) være misledende. Men hvilken kunnskapskilde skulle så det være? Heller ikke den 9

10 evidensbaserte forskningen, og de systematiske observasjonene den bygger på, kan påberopesegenslikufeilbarlighet.manifestethevderdahellerikkedette,noesomville væreåhengisegtilennyautoritetstro.derimotsiesdet(s.4)at detnyeparadigmetvil verdsette autoritet mye lavere enn det gamle. Men mange fryktet at dette kun gjaldt autoriteten til fagpersoner og eksperter, og ikke omfattet den nye autoriteten til den merupersonligeevidensbasertekunnskapen. Manifestetmanglerialletilfellerengjennomgangavmuligefeilkilderknyttettildetnye paradigmetskunnskapsbase.ogutsagnetomatautoritetheretterbørverdsetteslavere, er åpenbar myntet på ekspertmeninger, idet neste setning lyder: Den underliggende oppfatningen er at leger kan oppøve ferdigheter til å gjøre uavhengige vurderinger av vitenskapeligevidens,ogslikbedømmetroverdighetenvedekspertmeninger. De nevnte ferdighetene går ikke minst på å lære hvordan en sorterer og evaluerer forskningslitteratur,etterkravenetilevidensbasering: evidensbasertmedisinkrever ferdigheter som ikke er del av en tradisjonell medisinsk trening. Dette inkluderer å definere pasientproblemet presist, samt hvilken informasjon som kreves for å løse problemet;åutføreeteffektivtsøkilitteraturen,finnedebesteavrelevantestudierog anvendereglerforevidensvurderingforåavgjørederesvaliditet. Dissereglenebleetterhverteksplisittutarbeidet.Idagerdetførstogfremstdesåkalte evidensproduserendeorganisasjonenesomaktivtbrukerdissereglene,somgrunnlagfor åutarbeidesystematiskeforskningsoversikter(sr=systematicreviews).legenavlastes slikforselvåmåtteleseogevalueredenprimæreforskningslitteraturen. Manifestet understreker ellers at evidensbasert medisin også bygger på tradisjonelle medisinske ferdigheter, så som forståelse av sykdommers fysiologi og sensitivitet for pasientersfølelsesmessigebehov.menogsåhermåfagligekspertiseogegneerfaringer understøttes av vitenskapelig evidens (s. 5): Det nye paradigmet går inn for å bruke teknikkerfraadferdsvitenskapenforåavgjørehvapasientervirkeligetterspørhossine leger,oghvordanlegersogpasientersadferdinnvirkerpåutfalletavpleie.endeligkan det her passe med randomiserte forsøk mht. ulike strategier for interaksjon med pasienter. RCT studier anbefales altså ikke kun for å teste ut effektene av medisinske preparater. Metoden blir generelt foreskrevet for alle intervensjoner og interaksjoner dereffekterkanmåles,inkludertmenneskeligerelasjoner. Atdettemanifestetherergittensåpassbredpresentasjon,skyldesatdetpåfleremåter eretgrunnlagsdokumentforevidensbevegelsen.opprinnelsentilbetegnelsenevidencebasedmedicinemådaogsåtilskrivesarbeidsgruppenbakdokumentet.denbleførsttatt ibruki1991avetmedlemavgruppen,dr.gordonguyatt.bedømtutfradetsformog innhold,forfattereogdateringpekermanifestetsegutsomdetnyeparadigmetscharter. 10

11 Som antydet eksponerer det også mange stridsspørsmål, som skulle komme til å stå sentraltidendebattensomfulgteogsomlangtfraeravsluttet. Enkorthistorikk Detsomblepresentertidet15 sidersmanifestethaddelengeværtunderforberedelse. Alleredetidligpå1970 tallethaddedenbritiskelegenarchibaldlemancohcrane( ) slått til lyd for å reformere den medisinske praksis. Cochrane var spesialist i epidemiologiogbiostatistikk.vektleggingenavstatistiskemetoderkomdaogsåtilåbli etsentraltkjennetegnforevidensbevegelsen. I boken Effectiveness and Efficiency(1972) rettet Cochrane en sviende kritikk mot den medisinskepraksis,somhanmentevarmerpregetavtradisjonerogekspertveldeenn avforskningsbasertekunnskaper.detsomgikkforåvære godeogvelprøvdemetoder bleikkeoppgitt,selvomforskningenhaddekjørtforbidem.etvesentligproblemvarat erfaringsbasertkunnskapilitengradfungererkumulativt.detinnebaratineffektiveog endogskadeligemetoderikkebleavslørt,ogatengjordesammefeilgangpågang.hvor dårlig det virkelig sto og står til er selvsagt omstridt. En leder i British Medical Journal hevdet i 1991 at bare 10 20% av medisinske tiltak er solid vitenskapelig forankret. Senere studier påstår at inntil 25% av behandlingene er unødvendige eller ogsåskadelige.(grol&grimshaw,2003.) Deeksaktetallenekanmanstridesom.MendeterlettåforståCochranesmotivasjonfor åvilleryddeoppidette.fremforaltvillehaninnføremerrigideforpliktelsertilmetoder og terapier, hvis effekt hadde belegg i statistiske forsøk. Men det krevde at legene var oppdatert på den medisinske forskningen. Og det var de ikke, spesielt hadde de almenpraktiserendelegeneingentradisjonforåetterstrebedet.menfremforalthadde de ikke tid til det. Med den eksplosive utviklingen innenfor alle grener av medisinsk forskning,vardetjoialletilfellervanskeligåholdetritt.alleredei1992måtteenlege lese17artiklerhverdagiåret,bareforåholdesegoppdatertidetindremedisinskefelt (Sackett et al. 1995). At legens hverdag var blitt mer stresset enn før, ikke minst med mer papirarbeid, gjorde ikke problemet mindre. Det utvidet bare ytterligere kløften mellom forskning og praksis. Mangelen på en faglig oppdatering gikk i siste instans ut overpasientene,somikkefikkdenbestebehandlingensomstotilrådighet. Problemetvar(oger)reeltnok,skjøntdetjokanbeskrivesogbetraktespåfleremåter. Selvomdetneppefinnesnoenkvikkfiks,kunneentenkesegflerestrategierforågjøre noemeddet.ågilegeneromsligogobligatorisktidtilfagligoppdatering,villeværeet naturlig tiltak. Det ville ikke minst gjøre legene bedre trenet til å orientere seg raskt i aktuellforskning,noedevillenytegodtavogsånårdevendtetilbaketilpraksis.menen slikstrategivilleselvsagtkunneblinoksåkostbar. 11

12 Nåkomverkendetteellerlignendeforslagopptilvurdering,dadetsnartblefunneten annenoglangtbilligereløsning:omlegeneikkehaddetidtilålesesegopppåmangeog langeogkrongleteforskningsartikler,såmåttedesammenfattes.vedmeta analyserav statistiske resultater i såkalte systematic reviews, kunne konklusjonen av flere studier gjengispåénside.slikkunnelegeneholdesegorientertomnyforskningutenåmåtte slite seg gjennom krattskogen av primær forskningslitteratur. Én side per dag makter alle å lese. Produsentene av disse kunnskapsoversiktene, blir kalt knowledgebrokers (kunnskapsmeglere).deutførernådetsommanifestetmentelegeneselvburdeståfor: arigorousmethodologicalreviewoftheavailableevidence. Evidensbevegelsenharideologisksinedyperøttersomgårflerehundreårtilbake,ikke minsttil1700 talletsbritiskeempirisme.mendensoffisiellehistoriestartetførsttidlig på1990 tallet,somnevntveddetepidemiologiskefagmiljøetvedmcmasteruniversityi Canada.DerfraspredtedensegraskttilStorbritanniaogUSA,etterhvertogsåtilresten aveuropaogandreoecd land.ogframedisinspredtedensegvideretilandrehelsefag som sykepleie, fysioterapi, aldersomsorg, psykologi, osv. Etter årtusenskiftet etablerte den seg også innenfor utdanning, i første omgang mer som en offentlig strategi for utdanningsforskningogskoleutviklingennsompedagogiskpraksis. GårviinnpånettsidentilU.S.DepartmentofEducation,servif.eks.atevidensbasering derregnessomenselvfølgeligogvesentligendelavskolensfremtid.eu kommisjonen (2007:8) har på sin side erklært at: Evidence based policy and practice should be the driverofreformineducationandtrainingsystems. OgOECDforsikretsammeåratogså de ønsket... increasing pressure for greater accountability and effectiveness in education policies and systems. Still available information does not provide the elements necessary for decision making, either because the rigorous research relevant to policy needs has not been conducted, or the research that is available does not suggestasinglecourseofaction. (OECD,2007:9) Den rigorøseforskningen (relevantforpolitiskebehov)somherettersøkes,ernettopp det som evidensbaseringen tilbyr. Dette forklarer også et påfallende trekk ved denne bevegelsen,nemligdensoffentligeellerhalvoffentligestatus.atenbevegelsebegrunnet i et vitenskapelig metodeideal blir offentlig promotert, er temmelig spesielt. Men så er evidensbevegelsendahelleringenvanligbevegelse.strengttatterdetfeilåsiatdener promotertavdetoffentlige,fordidetgirinntrykkavenslagsngomedoffentligstøtte. MendetfinnesingenForeningforEBPderute.Detsomfinneserenoffentlig(somregel statlig)utviklingsstrategiforhelseogskole,somevidensbevegelsenerenintegrertdel avellerharetpolitiskmandatfra.visstharbevegelsensineengasjertetilhengere,men 12

13 det er ikke til hinder for at den retorisk, administrativt og finansielt er drevet frem av detoffentlige. Gjennominternasjonalenettverk,somsamordnersinforskning(Cochrane ogcampbell Collaboration), er evidensbevegelsen i sin grunnkarakter internasjonal. I Norden var DanmarkogSverigeforegangslandfordettesamarbeidet.DetNordiskeCochraneCentre startetoppalleredei1993.detnordiskecampbellcenter,rettetinnmotsosialtarbeid, kriminologiogutdanning,bleetablerti2002.ogforskolefeltetbledanskclearinghouse foruddannelsesforskningoppretteti2006. INorgebleNasjonaltKunnskapssenterforHelsetjenestenoppretteti2004.Derarbeider detnåca.150personer.kunnskapssentereterdennorskesamarbeidspartnerbådefor det internasjonale Cochrane og Campbell samarbeidet. Under Høgskolen i Bergen ble det i 2006 etablert et Senter for kunnskapsbasert praksis, som vesentlig retter seg inn mot helse og sosialfag. Til dette senteret er det knyttet rundt 20 stillinger, derav to professorater.norskemyndigheterharsålangtværttilbakeholdnemedåskyvepåfor en evidensbasert skole. Men pr ble det etablert et nasjonalt Kunnskapssenter for utdanning under Norges Forskningsråd. Foreløpig er det snakk om en beskjeden begynnelsemed5 7stillinger. Hvamenesmedevidensbasering? Atnoeerevidentbetyratdeterklart,innlysende,opplagt.Etymologiskkommerordet fralatin:ex videre,somharbådemedutsynoginnsynågjøre,atnoeeråpenbartforøye somforsinn.(jf. video og viden frasammerot.)detlatinskeevidens,harsittengelske motstykke i ordet evidence. Vanligvis oversettes det med bevis. Men engelsk skiller mellomproofogevidence,dervipånorskbrukerettogsammeord.mens proof stårfor etlogiskellermatematiskbevis(somgårpåinnsikt),gjelder evidence detvimedetnoe svakereuttrykkkankalleetempiriskbelegg.detsomordetevidensholdersammen(se oginnse),tendereraltsåiengelskspråkbruktilåsplittesito.derevidenshenvisertilen enhetavideellogempiriskvirkelighet,harevidenceenslagsidemotdetytre,empiriske. Denne anglosaksiske bias 1 har, som vi etter hvert skal se, ikke bare etymologisk interesse.denbetegnersnarereetsentraltkonfliktmotividebattenomevidensbasering, nemligomhvilkenstatusevidensforståttsominnsiktskalhaiforholdtilevidensforstått somempiriskbelegg. INorgeerevidensetfremmedord.Detsominternasjonaltheterevidensbasertkallesher oftekunnskapsbasert.gittatevidensogkunnskaperklareplussord,erdetretorisksett likeumuligåværeimotdetenesomdetandre.skjøntnårethelseforetakellerenskole 1 Bias er et mye brukt ord i engelsk-amerikansk akademia. Det har en hel skog av beslektede betydninger: fordom, vinkling, skjevhet, forutinntatthet, partiskhet, tendens, ensidighet. 13

14 går inn for en kunnskapsbasert praksis, må en jo spørre seg hva de gjorde før. En spesiell retorisk utfordring er uttrykket evidencebased knowledge, som en klokelig harunngåttåoversettetilkunnskapsbasertkunnskap.detkalleshellerforskningsbasert kunnskap.detspørsmåletsomdameldersegerom forskning kanjevnføresmed(eller reduserestil)detsomherbetegnessom evidence.detfårvineppesvarpåvedågrave ossdyperenedidetretoriskeaspektet.derimotmåvigåinnpårealitetenebak. Somalleredeantydeterdetendivergensmellomdetoriginalebegrepet evidens ogden meningordetharfåttievidensbasering.denforskjellenskalvikommetilbaketil.dette delkapitlet skal imidlertid fokusere på det siste, slik det fremgår ved det som gjerne kalles produksjonen av evidensbasert kunnskap, heretter ofte forkortet til EBK. Neste kapittel går så inn på hvordan denne kunnskapen er ment å bli implementert i en evidensbasertpraksis(ebp). EBKdreiersegvesentligomreglerogmetoderforåselekterekunnskap.Hvordandette skjerogbørskje,eretsentraltstridsspørsmål.menhvamedselveprinsippet,somogså kan kalles en metodisk eksklusjon av data? I akademiske sammenhenger blir dette vanligvis oppfattet som et likeså nødvendig som rasjonelt kognitivt prinsipp. Det mest nærliggende argument for en slik prosedyre, er at all informasjonsinnhenting er selektiv.dettegjelderselvheltenklepersepsjoner.bådenårviseroghører,stårkundet tydeligfremsomerinnenforvårtoppmerksomhetsfelt.detsomerutenfor somregel detallermeste misterdeklarekonturene;detblirtendensielt bakgrunnsstøy. Hvavirettervåroppmerksomhetmot,perseptueltsomkognitivt,avhengeraltsåavvår aktuelleogstadigskiftendeinteresse.densystematiskeseleksjonenreferertovenforeri så måte mer rigid og uforanderlig.mens et menneske hele tiden skifter fokus, og slik over tid fanger inn en vid kontekst, er et fokusert system iprinsippet kontekstblind. Dettegjelderendamernårsystemeterinnrettetforåavvise subjektiveintervensjoner iformavskjønnogsituasjonsbetingedeunntak. Hva skjer med den informasjon som selekteres vekk?det står fortsatt enhver fritt å leseprimærlitteraturen,sålangtsomdehartidtildetoginteressefordet.menforden aktuellekunnskapsoversikten,veierdeningenting.menneskertarinnmyeisideblikket. Vi kjennertil og harhørtom mangtviikkeharsattossskikkeliginni.informasjon somslikfangesoppavsideblikket,kansenerevisesegåledeosstilnyeoppdagelser.vi tar hint og ser nye sammenhenger. Formaliserte systemer har generelt ikke noe sideblikk,ogtaringenhint.informasjonsomselekteresvekk,ogslikikkedefineresinni systemet, er i prinsippet ikke eksisterende. Dette gir en stivhet i form av manglende 14

15 evnetilålæreogendreseg.systemerkangenereltikkeendresineegneregler. 2 Skalde redefineresmådetalltidskjeutfraindividerskreativevurderinger. Herfølgeretkonkreteksempelpåhvorhårdhendtenslikseleksjonsprosesskanvære.I 2008lagetDanskClearinghouse,påoppdragfradetnorskeKunnskapsdepartementet,en systematisk oversikt over foreliggende forskning mht. hvilken type kompetanse i barnehageogskolesombidrarmesttillæringhosbarn.førsteleddiseleksjonsprosessen eralleredelagtinnisystemet,idetensøkerispesifikkejournalerogdatabaservedhjelp av spesifikke søkemotorer og søkeprofiler. Alt som faller utenfor dette kommer ikke opp, ikke engang som titler. Det første søket gav ikke desto mindre over 6000 treff av muligrelevanteartikler,rapporterogundersøkelser. Å lese alle disse artiklene er uaktuelt. Så en første screening skjer ved at en ser på titler, og skummer over artiklenes sammendrag (abstracts) for de som anses mest relevante.nåstoenigjenmed70artikler,somvarbedømtsomtematiskrelevante.den neste seleksjonen skjer ut fra metodiske kriterier. Her ble 15 artikler valgt bort, da studiene hadde lav forskningskvalitet. En sto altså til slutt igjen med 55 artikler som skullefinlesesogsammenfattes. På Kunnskapsdepartementets nettside (www.regjeringen.no)annonseres resultatet av denaktuellekunnskapsoversiktenslik: Forførstegangvetvimedstorsikkerhethvilkekompetanserenlærermåha:Solid fagkunnskapogevnentilåformidledennekunnskapentilelevene. Det er vanskelig å tenke seg en innsikt som er mer selvfølgelig og evident for elever, lærereogforeldre. Forførstegang mådabetyatselvdemestlogiskselvevidenteog solideerfaringsbasertekunnskaperikkeharnoenvektførharfåttevidensvektgjennom ensr.detteblirikkemindreklart,skjøntdeaktuellekompetansersenerespesifiseres tilfølgendetre: Kompetansetilåledeklassen Fagfordypingoggenerelldidaktiskkompetanse Kompetansetilåinngåiensosialrelasjonmeddenenkelteelev Utenforkleinelseforsammenfatningen,ogforskningenbakdenne,såkanenvelantaat hellerikkedissekonklusjonenekomsomnoenbombepånoenpedagog. Mendetskalogsåsiesatførdenneenkleogselvfølgeligekonklusjonenlyserimotoss,er viblittforsyntmedtrenyefagtermer,somkanimponeremange: 2 Såkalt lærende eller selvprogrammerende datasystemer danner intet unntak. Også de baserer seg på algoritmer og formaliserte regler, som på ett eller annet nivå må genereres og endres av en bevissthet. 15

16 Relasjonskompetanse(Evnentilåkunneetableregoderelasjonertilbarna,bl.a. vedelevaktivering,elevmotiveringogåtahensyntilulikeelevforutsetninger.) Regelledelseskompetanse(Evnentiltydeligledelseavundervisningen,herunder ogsåevnentilågieleveneansvaretforåopprettholdeogutformeregler.) Didaktikkompetanse(Høytfaglignivåkombinertmedevnentilåformidlefaget.) Det som sies med disse lange nyordene, er selvfølgelig ikke stort mer enn det som er sagtmedkortereogenklereordovenfor. Somnevnterdetikkemeningenatkunnskapsmeglerneskalleseallforskningslitteratur innenfor hvert spesialfelt, eller angående et bestemt spørsmål. Allerede stoffmengden gjør dette så godt som umulig, selv for dem. Også dette taler for å ha klart definerte seleksjonskriterier for utvalget av artikler. Som epidemiolog var Archie Cochrane dedikerttilbiostatistiskemetoder.ogdetsomkomtilåbliregnetsomgullstandarden for evidensbasert kunnskap, ble da også såkalte RCT studier, dvs. randomiserte forsøk med kontroll. Randomisering betyr her at fordelingen mellom intervensjonsgruppe og kontrollgruppeskjertilfeldigforallesomdeltar.desomhavnerikontrollgruppenfår, alt etter omstendighetene, placebo eller ingen behandling. Slike forsøk vil typisk også være dobbelt blindet, slik at verken forsøksledere eller deltakere vet hvem som er plassert i hvilken gruppe. Om resultatene skal ha statistisk signifikans, må forsøkene omfattemangeenkeltutfalloggjentakelser.dablirdetidkrevendeogkostbare,noesom begrenserhvilkeforetaksomkanståfordem. MeddenstatusRCT metodenetterhvertharfått,blirdetimidlertidgjennomførtmange småstudier,somistatistiskforstanderlitepålitelige.ismåstudierkanrandomisering fallemegetskjevtut.eteksempelkanværeometforsøkomfattet4personersomskulle fordelespåenintervensjons ogkontrollgruppe.omde4var2kvinnerog2menn,ville detimangetilfellerværebeståopprettekjønnsblandetegrupper.omenrandomisering førte til kjønnslike grupper, kunne dette føre til en skjevhet (bias). Eksemplet er såre enkelt,menkanvarierespåmangemåterutenatdetprinsipielleproblemetelimineres. Poenget er helt enkelt at kvaliteten på RCT studier, lik enhver annen metode, varierer fra de aller beste til de som er helt ubrukelige. Men om enhver RCT studie gir bedre evidens ennenhverannenstudie,harmannettoppikketatthensyntildette(grossman, 2008;Grossman&Mackenzie,2005). Evidenshierarkiet Etsliktprinsipperikkedestomindrelagttilgrunnidedominerendeevidenshierarkier(i Norge ofte kalt kunnskapshierarkier). Åpenbart dårlige RCT studier plasseres riktignok påetlavereevidensnivåenndegode.mendetrumferuansettalleandredesign,bortsett 16

17 frakohortstudierogstudieravtypen alleelleringen. 3 Ietsliktevidenshierarkierdet som regel fem hovednivåer (levels of evidence). Her blir kvalitative studier ofte ikke regnetmed.selvendårligrctregneshersombedreenndebestekvalitativestudierog observasjonsstudier(jf.fig.1). 1a 1b 1c 2a 2b 3a 3b EvidensnivåbruktvedCEBM,Oxford forterapi,forebygging,etiologiogskadevirkninger Systematiskereviews(SR)avRCT EnkeltståendeRCTavgodkvalitet Alleelleringen SRoverkohortstudier EnkeltståendekohortstudierogdårligeRCT SRovercase kontrollstudier Enkeltståendecase kontrollstudie 4 Case serier,samtdårligekohortstudier 5 Ekspertuttalelserbasertpåfysiologi,laboratorie forsøkeller firstprinciples Figur1:EtevidenshierarkiutvikletvedOxfordCentreforEvidence BasedMedicine. Kilde:http://www.cebm.net/index.aspx?o=1025 Skjønt det er mange varianter av slike evidenshierarkier, ligger hovedmønsteret fast: Øverst rangeres SR og RCT. Dernest kommer andre kvantitative studier med statistisk design. Nederst kommer ekspertmeninger og grunnforskning. Kvalitative studier av ulike slag, kontekstuelle analyser, intervjuundersøkelser og observasjonsstudier, faller gjerne ut av listen. Evidenshierarkiet fremstilles ofte i form av en pyramide, som i følgendeeksempelfradukeuniversity(figur2).hellerikkeidenneevidenspyramiden erkvalitativestudierinkludert.skjøntdetfinnessystematiskeforskningsoversikterder slikestudiererinkludert,erdetinternasjonaltenklartendensmotensmalevidensbase. FossHansen&Rieper(2009)girenenkeloversiktoverulikeevidensbasersomenslik forskningsoversikt kan legge til grunn. Disse fordeler seg på fire felt, alt etter om oversiktengårutfraensmalellerbredevidensbaseogomdenpretendererågiglobal ellerlokalevidens. Jo flere typer forskning som inkluderes i oversikten, jo bredere er evidensbasen. En forskningsoversikt med smalest mulig evidensbase anerkjenner kun studier med RCTdesign.Enpretensjonomglobal(elleruniversell)evidens,betyratkunnskapeneerment ågjeldeforallverden.detteviltypiskværetilfelleforsomatiskmedisin,sidenkroppene våre stortsett erbygdliktogfungererliktverdenover.menogsåhererdetunntak. 3 Kohortstudier gjelder langtidsstudier av en bestemt gruppe individider med bestemte karakteristika. Alle eller ingen er studier med 100% utslag den ene eller andre veien. 17

18 Strengttatterjohellerikkefysiologielleranatomifullkomment globale.herfinnesså velindividuellesometniskeulikheter,somimangetilfellerkanhabetydeligrelevans. Figur2:EBK pyramiden,somviserevidenshierarkiet. Kilde:DukeUniversityMedicalCenterLibrary. Innenfor fag som f.eks. psykologi og pedagogikk, må en ofte nøye seg med en lokal evidens (dette virker her). Om en har funnet ut at visse psykoterapier virker bra i et tradisjonelt fangstsamfunn, er det ikke sikkert at de samme metoder virker like bra blantnewyorksinnbyggere. Tabell1:Evidenstenkning(etterFossHansen&Rieper,2009) Smalevidensbase Brede(ere)evidensbase Globalevidens Lokalevidens A:Globaleoversiktersomkun inkludererrct studier. C:Regionaleellernasjonale oversiktersomkuninkludererrct B:Globaleoversiktersominkluderer primærstudiermedulikedesign. D:Regionaleellernasjonale oversiktermedulikedesign. FossHansenogRieper(2009)sieromdette: Både Cochrane og Campbell er således fortalere for, at evidensbevægelsen bør praktisere med afsæt i evidenshierarkiet, der rangordner forskningsdesign og betragter randomiserede kontrollerede forsøg som det bedste og det efterstræbelsesværdige. [ ] Cochrane og Campbell organisationernes evidenspraksis placerer sig altovervejende i felt A. Dog findes der eksempler på systematiskereviews,dererbaseretpåenbredereevidensbasis,idetderinddrages resultaterikkealenefrarct baseredeforskningsdesign,menogsåfraandretyper av kontrolgruppedesign (felt B). Men disse eksempler er omdiskuterede i de to organisationer.(minutheving.) 18

19 Systematiskereviews(SR)dannertoppsteinenievidenspyramidene.Detteinnebærerat kunnskapsentrenes egne anbefalinger, basert på slike oversikter, rangeres høyere i evidensverdi enn enkeltstående studier, selv av RCT design. Hvordan er det mulig å summere kunnskap på denne måten, og gi den en slik status? Teknisk sett er bakgrunnen helt enkelt at statistiske belegg får større vekt jo flere tilfeller som er undersøkt.oppsummeringenavdetstatistiskematerialeterenrentteknisk matematisk sak, som skjer ved såkalte meta analyser. Forutsetningen er at de aktuelle studiene undersøkerdesammespørsmål,meddesammemetoderogpåsammetypeempiriske materiale.dettemåvurderesfrasaktilsak.forøvrigskalensrbasertpårct studier skjevedstandardiserteprosedyrer,medminstmuligromfor subjektivevurderinger. Nåerdetingennyoppfinnelseålageforskningsoversikter.Slikeerdetmangetyperav. Enhver forskningsartikkel har som regel med en kort oversikt over tidligere forskning påområdet.iavhandlingergisslikeoversikteroftestorplass.oglærebøkerkansieså værereneforskningsoversikter,omennavvarierendekvalitetogdybde.fosshansen& Rieper(2009)listeroppseksuliketyper: Systematiske forskningsoversikter etter idealene om evidensbasering, dvs. med meta analyseravrct studiersomdensentralemetoden. Narrativeforskningsoversikter,somsyntetisererflerestudierpåenargumentativ ellerfortellendemåte. Konseptuelleforskningsoversikter,somsyntetisererbegrepsmessigvitenoggiret overblikkoverideer,modellerogdiskusjonerpåetområde. Realistiskeforskningsoversikter,somistedetforåsummereresultateneavflere enkeltstudierrettersittfokusmotteorienbakstudiene.slikeoversiktertarsikte på at producere generaliserbar viden om den programteori, indsatsen er forankreti. Klassiskeforskningsoversikter,somforeksempellæreboksoversikterogbredere litteraturoversikter. Kritiske forskningsoversikter, som uten å bruke formaliserte metoder har en kritiskanalyseaventeoriellerhypotesesomsiktemål.hervildabådemetoder ogresultatertilgittestudierkunnedrasinnigrunnlagetforanalysen. Ofte vil det også forekomme forskningsoversikter som ikke så lett lar seg klassifisere, f.eks.fordidedekkerflereavdissetypene.ogdetfinnesdrøftende,kritiskeoversikter, somgiretoverblikkoverideer,modellerogdiskusjonerpåetområde,utenåværerene forskningsoversikter.nærværenderapportkanværeeteksempelpådette. DetmåpådennebakgrunntascumgranosalisnårFossHansen&Rieper(2009)åpner medåerklæreat: Deninstitutionaliseredeevidensbevægelseudgørennytypevideni formafsystematiskeforskningsoversigter. Hvasomkankalles ennytypeviten,eret skjønnsspørsmål. Men det nye ved evidensbasert kunnskap er i alle tilfeller ikke å lage 19

20 forsknings ogkunnskapsoversikter.derimotharebktresentralekarakteristika,somer nyeiforholdtilalleforegåendetyperavkunnskapsoversikter: 1. denrigideogformaliserteprosedyrenvedseleksjonavkunnskap, 2. den smaleevidensbasen,avgrensettilstatistiskemetoderogrct, 3. denstatusellerautoritetsomtilleggesdisseoversiktene. Alledissetrefaktorenekanvarierenoefralandtillandogfradetenekunnskapssenter tildetandre.noeninkludererf.eks.kvalitativestudierietvisstmonn,mensandreikke gjør det. Men evidensbevegelsen er primært en internasjonal kultur, der aktørene samarbeider og i stor grad følger standardiserte prosedyrer. Dette samarbeidet er formalisertnårdetgjeldercochrane ogcampbell organisasjonene. Hvasomvirker Girdetsågodmeningåavgrense forskningsbasertkunnskap tilsystematiskereviews, vesentligbygdpåmeta analyseravrct studier?skjøntevidensretorikkenanvenderen slik talemåte, hevdes det ikke desto mindre at kriteriene kun gjelder for effektstudier, ellerhvasomvirker.nortvedt&jamtvedt 4 (2009)understrekerdetteslik: Evidensbevegelsen er blitt oppfattet som om den fremhever en type kunnskap somviktigereennandre,ogatrctergullstandard.viharutalligegangerpresisert atrctikkepassertilåbesvarealletyperspørsmålogathierarkietsomviogsåher harforsøktåbeskrive,handleromeffektspørsmål. Dettebringerossrettinntilkjernenavbegrepetomevidensbasering. What works er verden over blitt det sentrale slagordet for evidensbevegelsen.det er ikke vanskelig å se fornuften i målet om at tiltak og metoder i alle profesjoner bør innrettesmotdetsomvirkerfremfordetsomikkevirker.konnerup(2009)nevnerf.eks. en rekke empiriske studier av sosialpolitiske tiltak (psykisk helsevern, rusbehandling, barnevern mv.), som viser negative virkninger av ulike tilbud og behandlingsopplegg. Disse funn kom som en stor overraskelse på fagmiljøet, og kunne vanskelig ha blitt avslørtutenvedeffektstudiermedkontrollgruppe.konnerupoppsummerer: der skal være et solidt teoretisk fundament, der underbygger, hvorfor man forventer, at indsatsen vil have en positiv virkning på klientens livskvalitet. Men hvis man vil sikre sig i sit professionelle virke, at man også rent faktisk gavner og ikke skader klienterne, så er et solidt teoretisk fundament for indsatsen ikke tilstrækkeligt. Det er også behov for at undersøge, om det rent faktisk i virkelighedengårklienternebedresomfølgeafindsatsen ellermedandreord er dernogetsomteorienharmisforståetelleroverset? Det som her er belyst ut fra det sosialterapeutiske feltet gjelder utvilsomt, skjønt på ulikevis,ogsåforandreprofesjoner.iallefallerdetneppenoensombetvilerbehovet 4 Professor Monika Nordtvedt ved Senter for kunnskapsbasert praksis, Høgskolen i Bergen og Gro Jamtvedt ved Nasjonalt kunnskapssenter for helsetjenesten. 20

21 foreffektstudier,hvismuligogsåmedrandomiseringogkontroll.debattenomebphar imidlertidofteblittpolarisertiretningavommanvar forellerimotrct ellerendog forellerimotempiriskestudier.mendetskalgodtgjøresåfinnenoenfagpersonersom er prinsipielt mot RCT studier eller tilsvarende kvantitative metoder. Spørsmålet er hellerhvilkenrolledeskalhaidettotalebildet. Dette synet legges også til grunn i denne rapporten. Randomiserte kontrollstudier er åpenbartetkraftigverktøyforågistatistiskbeleggforvisseeffekter,spesieltslikesom errelativtsvake,samtuniverselleoglitekontekstsensitive.mendetbetyrikkeatslike studiererbestegnettilalletyperspørsmålogfagligekontekster. RCT studierbleførstansettforågi bestevidens vedterapeutiskeavgjørelser(sackett et al., 1996). I tidens løp, og med eksport til andre profesjoner, har evidensbasering imidlertidtenderttilåbliregnetsom bestevidens overhodet.vitenskapsteoretisker detimidlertidikkenoegrunnlagforetkravomengenerellepistemiskoverlegenhetfor RCT studier. Et slikt krav fremmes da heller ikke av metodens mest informerte proponenter. I mange harde vitenskaper, som fysikk, er randomiserte kontrollforsøk ofte uaktuelt. Derimot kan det ene eksemplet ( den hvite kråken ) som verifiserer en omstridt hypotese, eller falsifiserer en anerkjent teori, være avgjørende. Det samme gjelder også i mange myke vitenskaper, som f.eks. arkeologi og historie, der kontekstforståelseerdensentralemetoden. Gittatvigenerelt(alleforbeholdforeløpigsatttilside)synsdeterbraåsatsepådetsom virker,kanvisåutenvideregåutfraatebp generelt erdetbestemidlettilåsikre dette?foråbestemmeomnoevirker,måviforutsetteatmålet(forhvadetskalvirke) eravgjort.itilleggtilåsikreossatvigjørnøyaktigemålinger,ogatdatabehandlingener statistiskholdbar,måviogsåviteatvigjørdemestrelevantemålingene.menakkuratpå dettepunktetgirrct metodeningenveiledning.hermåvimobilisereinnsiktikontekst og kausalitet (jf. del 2). Paradoksalt nok avhenger RCT studier slik av vurderinger og innsikteravdentypensomstårnederstievidenshierarkiet,somf.eks.ekspertmeninger. Bestevidens representereraltsåikkeenprimærepistemologi;denmåselvbyggepåen epistemologisomdenoffisieltregnersomunderlegen. SomEkeland(2009)ogflereharpåpekt,erspørsmåletomEBPvirkerbest(iforholdtil alternativestrategier)etempiriskspørsmål.menevidensenfordettefinnesikke.atden hellerikkekanproduseres,varklartfrabegynnelsenav.i1992 manifestetsiesdetslik: Theproofofthepuddingnårdetgjelderevidensbasertmedisinerompasienter,som pleiespådennemåten,nyterenbedrehelse.dettebeviseterikkemeroppnåeligfor det nye paradigmet enn for det gamle, for det er lite trolig at noen langsiktige randomiserteforsøkavtradisjonellogevidensbasertmedisinvilbliutført. 21

22 Såvetvidet.Nåermåletomåsatsepå detsomvirker isegselvinstrumentelt.detvil si:detharnokennormativform(vibørsatsepådetsomvirker),mendenneformener uteninnholdsålengeviikkeharbestemthvilkeeffektervivilprioritere.hvilkemålet tiltakskalha,kanværeevidentnokvedetbeinbrudd.meniandretilfellermåviforeta komplekseavveininger,derfaglige,sosialeogetiskehensynskalveiesinn.dettegjelder allepraksisfeltderviverkenkanellerbørunngååtahensyntil helemennesket,pluss denvideresosialekonteksten.strengttattblirdetallepraksisfelt.menproblematikken blirmestakuttderdet(ogsåoffisielt)er helemennesket somer tilbehandling,slik tilfelleteribarnevern,pedagogikk,aldersomsorg,osv. Etannensakerhvilkemidlerviavetiske(ellerandre)grunnerervilligtilåbrukeforå oppnåetgenereltmålomeffektivitet.ivårtsamfunnvilenempiriskevidensforatfysisk avstraffelseerdetsomvirkerbesttilåholderoiklassen,ikkegjeldesometargument for å ta det i bruk, bl.a. fordi vi derved medlærer elevene at fysisk vold kan være et akseptabeltmiddelforånåetgittmål.kjetilsteinsholt(2009),professoripedagogikk vedntnu,brukerdetteeksempletforåviseat innenforpedagogikkenvilmidlerog målikkeværeknyttetsammenpåenytreogteknologiskmåte.demidlenevibrukeri pedagogikkenerikkenøytralenårdetgjelderhvilkemålvivilrealisere. Ettredjespørsmålgjeldereffektenavåstilleeffektspørsmålisentrum.Dettekommertil uttrykkpåfleremåter,bl.a.iordvalgogretoriskevendinger.eteksempel:intervensjon forbindesgjernemedmilitærekonflikter.menordeterogsåflittigbruktimangeandre sammenhenger,f.eks.avevidensbevegelsen.enlegesintervensjonkanværeåordinere eller å suspendere en terapi. En lærer kan tilsvarende ordinere øvelser og leselekser, fortelleenhistorie,viseenfilmellerresitereetdikt.altdetteleggerbeslagpåelevens tidogkrefter,medbestemtepositiveellernegativevirkninger.strengttattkanaltsom en profesjonsutøver gjør (eller bevisst unnlater å gjøre) i en klientrelasjon kalles en intervensjon.ogintervensjonerharalltidbestemteeffekter,somiprinsippetkanmåles. Her gjelder altså Galileo Galileis slagord: Mål alt som er målbart. Gjør alt målbart som ennåikkeerdet. Hvisaltsomskjerienprofesjonsrelasjonbliroversatttileffektspråket,hjelperdetikke såmyeatevidenshierarkietkunhandleromeffektspørsmål.overaltderdennenormen vinnerfotfeste,vildetskjeeninvasjonaveffekttenkning.ieffektspråketfinnesdetingen normativekategorier.detsomførvarenintegrertnormativogfagligpraksistenderer slik mot å bli en rent instrumentell praksis. Evidensbaseringens egen logikk har ingen normativebegrensningerforenslikinstrumentalisering.omvisåvil,kanaltoversettes tileffektspråket. Evidence BasedEthics erdaogsåalleredeintrodusertsometbegrep viharallgrunntilåtaalvorlig,(eks.tyson&stoll,2003). 22

23 Deterallmentakseptertatdetinoentilfellervilværeuetisk,upraktiskelleruforsvarlig åanvenderct design.vilarikkefolkmedenpotensieltdødeligsykdomståiventekø lengerenndemå,selvomderepresentererenkontrolloverfordesomfårbehandling. Mensettbortfrasliketilfeller,betraktesRCTsom denmestrobustefremgangsmåten forevalueringavallemuligeeffekter: Cochrane Collaboration og Nasjonalt kunnskapssenter for helsetjenesten har begrenset sine kunnskapsoppsummeringer til primært å dekke effektspørsmål. Randomiserte kontrollerte studier (RCT) representerer den mest robuste fremgangsmåten for å vurdere effekten av et tiltak, det være seg forebygging, behandling, rehabilitering eller organisering av tjenester. (Nordtvedt & Jamtvedt, 2009) Gittevidensbaseringensfokuspådetsomvirker,erdethelleringenstoroverraskelseat kunnskapssentre verden over vesentlig arbeider med effektspørsmål. Michael Søgaard LarsenvedDanskClearinghousegikki2009gjennom275systematiskereviewsfrasyv ledendeinternasjonalekunnskapssentreforutdanning: 61% av disse bruker evidenshierarkiet rigid, slik at kun meta analyser, randomiserte kontrollerte forsøk og andre kontrollerte eksperimentelle design kanværemed. 82% av oversiktene handler om effektspørsmål, 22% tar opp deskriptive spørsmål, 15% behandler spørsmål om måloppnåelse, 9% angår kausale spørsmålmens7%inneholderholdnings ellermeningsspørsmål. Bådedominansenaveffektspørsmålogtendensentilenrigidbrukavevidenshierarkiet, ermarkert.somlarsen(2009)viderefremholder,hareffektspørsmålsålangtikkevært dominerendeidenpedagogiskeprimærforskningen.atetsliktfokusblirprioritertved de nasjonale kunnskapsentrene for utdanning, vil potensielt kunne dreie pedagogisk forskning over mot effektspørsmål. Det kommer bare an på hvilken autoritet disse sentreneetterhvertfår.mensidenevidensbevegelsenistorgraderdrevetfremavdet offentlige, som også forvalter forskningsmidlene, er scenariet nokså realistisk. Larsen (2009:15) oppfatter dette som evidensbevægelsens største udfordring og problem. NestlederiUtdanningsforbundet,PerAahlin(2009),uttrykkerdesammebekymringer. Når forskningsbasert kunnskap i stor grad innskrenkes til statistiske og kvantitative studier,betyrdetenmarkertredefineringhvaviforbindermed forskning såvelsom kunnskap.enslikutviklingskjerikkevedeteksplisittvedtak.denskjerhellerikkeved at det reises en vitenskapsteoretisk debatt om disse komplekse begrepene. Det skjer derimotlangsomtogumerkelig,ogsomekeland(2009)fremholder,overtotrinn: Mankommunisererførstengenerellregel(brukedenbestekunnskap),forderetter [ ] å forholde seg til ekstremt spesifikke regler for den beste kunnskap. Slik okkupereskunnskapsbegrepetidetstille,utenvarsling. En ideologisk redefinisjon av denne karakter er ikke uproblematisk, spesielt ikke når denharetoffentligmaktapparatiryggen. 23

24 Kapittel2:Frakunnskaptilpraksis EBKversusEBP INorgeharevidensbølgen,ogdebattenomden,ilitengradnåddutoverhelsesektoren. Mangeavdeproblemstillingersomherharkommetopp,erimidlertidavenprinsipiell karakterogvilværelikeaktuelleforalleprofesjoner.eteksempelpådetteerdrøftingen avforholdetmellomevidensbasertkunnskap(ebk)ogpraksis(ebp). IstoretrekkhardebattengåttpåhvordanEBKskalimplementeresipraksisfeltet,utenå overstyredetpraktiskeskjønn.allesynesåværeenigeomatpraksissnarerebørvære forskningsinformertennforskningsinstruert.praksisbørfortsattpregesavindividuelle vurderinger på stedet,dermangehensynskalivaretas.detfremholdesatideenomen kunnskapsbasert praksis (=EBP) nettopp innebærer en slik integrering, og ikke en direkteimplementeringavforskningsbasertkunnskap(=ebk). DettesynesdaogsåågåfremavdeoftesitertedefinisjoneneavEBP.Laosssepånoen eksempler.sackettetal.(1996)definererevidensbasertmedisinslik:åpraktisereebm betyr å integrere individuell klinisk ekspertise med den best tilgjengelige kliniske evidens frasystematiskforskning.henvisningentil individuellkliniskekspertise innebæreren konsesjontildetfagligeskjønnet.menandrehensyn,somf.eks.pasientensinteresserog verdier,erikketattmed.ettermyedebattomdetteredefinertesackettetal.(2000)sin definisjonslik:ebmerintegrasjonenavbestforskningsevidensmedkliniskekspertiseog pasientverdier. TilsvarendedefinisjoneravEBPinnenforandrefagfeltharfulgtidetsammesporet.Alle refererer til best tilgjengelig empirisk evidens eller lignende uttrykk, hvis spesifikke meningfølgeravevidenshierarkiet.detteskalsåintegreresmed profesjonellvisdom eller individuellekspertise.pånettsidentiltheusdepartmentofeducation,defineres evidensbasertutdannelsesom:integreringenavprofesjonellvisdommedbesttilgjengelig empiriskevidens,vedavgjørelseromhvordanenskallevereinstruksjon. 5 Brukenavtermerfraindustrioghandel(evidens produseres oginstruksjon leveres ) eridennesammenhengikketilfeldig,noeviskalkommetilbaketilidrøftingsdelen.en kanellersstusseoveratundervisningerforståttsomå levereinstruksjon.herfinnes intet spor av et interaktivt perspektiv, eller at undervisning omfatter noe mer enn den kognitive kunnskapsformidlingen.etviktigspørsmålblirdaomdetteeretuttrykkfor evidensideologien,ellerkunettypisktrekkvedamerikanskskolepolitikk. 5 U.S. Department of Education 2002: 24

25 DeterialletilfellerklartatEBKikkeermentåskulleoverføresdirektetilpraksis.Åville minskegapetmellomforskningogpraksisbetyrikkeåvillelukkedet.mindthegap,vil fortsatt være en god påminnelse. Skjønnet, der faglige så vel som rettslige, sosiale og etiskeaspekterspillerinn,skalforblibasisforintegrasjonen.slikeridealene.erdetså noengrunntilåtroellerfrykteatrealitetenekanbliannerledes? De mange hensyn som en evidensbasert profesjonspraksis (lik all profesjonspraksis!) måintegrere,speilesiintegrasjonsmodellen,somfigur3viserenvariantav. Forskningsbasert kunnskap Rettskilder Verdier Ressurser Politikk Kunnskapsbasert praksis Erfaringsbasert kunnskap Brukerkunnskap og brukermedvirkning Figur Figur3:Integrasjonsmodellenavkunnskapsbasertpraksis.Kilde:Sollesnes(2006). 1: Kunnskapsbasert praksis (Mørland 2004) I denne modellen er praksisfeltet et møtested for mange interesser, og der flere typer kunnskapogverdierskalintegreres vedskjønn.ogdenenestesomkanforetaetslikt Kunnskapssenteret s bidrag til kunnskapsbasert praksis er primært å bringe inn skjønn, er som før den ansvarlige profesjonsutøveren. Slik sett viser modellen kun et forskningsbasert kunnskap, mens det er opp til praksisfeltet å diskutere og utvikle de andre grovt kart over kompleksiteten i en ansvarlig profesjonsutøvelse, slik den bør skje i et elementene i modellen 6. Kunnskapssenteret arbeider etter den systematiske metoden for modernedemokrati.atnyekunnskapskildersomebkkommertil,erforsåvidtverken særlig innhenting oppsiktsvekkende og bearbeiding eller av kunnskap truende. Det som faktum er utviklet at mange gjennom evidensforkjempere Cochrane-samarbeidet. har Det endret er sterke retorikken bindinger fra mellom kunnskapsbasert evidence-based praksis medicine til kunnskapsinformert og kunnskapsbasert praksis, praksis, men kan både også innen virke Nasjonalt beroligende kunnskapssenter for de som og fryktet Cochrane-samarbeidet at de nå skulle overstyres erkjennes av det instrukser at kunnskapssynet fra stadigmermektigekunnskapssentre. som evidence-based medicine bygger på i mange sammenhenger blir for snevert, eksempelvis i forhold til helsefremmende arbeid og tiltak innen folkehelsearbeidet. Skjønnversusinstruks Det er imidlertid visse grunner til å problematisere denne harmonimodellen, hvor Som tidligere nevnt har diskusjonene i norske fagmiljøer stort sett vært sentrert rundt gjerneviennmåtteønskeatdenvarsann.etåpenbartkonfliktmotivliggeridetfaktum forskningsbasert eller evidense-basert kunnskap, og de andre hjørnesteinene i begrepet at evidensbevegelsen, historisk som ideologisk, ikke tillegger personlige erfaringer og kunnskapsbasert praksis har vært viet mindre oppmerksomhet. Dette gjelder også innen vurderingernoenevidensvekt.forevidensbasertkunnskapgjelderuinnskrenketidealet opplæring, hvor det har vært lagt stor vekt på å finne frem til og vurdere forskningsbasert omobjektivekriterieroghårdstatistikk.derforhavnerdaogsåprofesjonellekspertise, kunnskap. Når kunnskapsbasert praksis i den senere tid har fått så sentral plass innen grunnlagetfordetfagligeskjønnet,påbunnenavalleevidenspyramider.somviharsett forskning, utdanning og praksis er det nødvendig å klargjøre hva som legges i begrepet, og er evidensbaseringen ikke desto mindre avhengig av at denne ekspertisen først avgjør også se på hvordan kunnskapsbasert praksis kan tilpasses ulike fagområder, i dette tilfellet hvaviskalspørreom,ellerforhvavitrengerevidensbasering. helsefremmende arbeid. 25 Det er etterhvert kommet mye litteratur om evidence-based health promotion, og innen WHO

26 Sammenlignerviflereslikepyramiderserviatprofesjonellekspertisedelerskjebnemed altfra ideer til nyhetsartikler og meninger. Figur4:Ennyvariantavevidenspyramiden.Kilde:NationalHealthService,UK Motstykkettildetobjektiveogsikreerdetsubjektiveogvilkårlige.Detopolenedanner topp og bunn i evidenspyramiden. Går vi til den internasjonale debatten, ser vi at vurderinger basert på skjønn karakteriseres med uttrykk som fads (motemeninger), fancies(lyster) og personal bias(personlige fordommer), USDE(2002). En kan ta slike uttrykksomen(iogforsegoverflødig)påminnelseomkjentemenneskeligesvakheter. Men en kan også lese dem som en objektivistisk kunnskapskulturs nedvurdering av personligeinnsikterogerfaringer. Hvis det siste gjelder, er det rimelig å spørre hvordan pyramidemodellen harmonerer med integrasjonsmodellen. Hvordan kan erfaringsbasert kunnskap være en legitim kunnskapskilde i den siste modellen, tilsynelatende likestilt med forskningsbasert kunnskap, når den alt er diskreditert i den første? Det er heller ikke kommet bud på hvordan konflikter mellom de to kunnskapsformer skal løses. Men det ligger vel i korteneatjevnbyrdighetenmellomdemilengdenikkevilvareved. En artikkel i Tidsskrift for den norske legeforening(2003), der evidensdebatten alt har pågåttiflereår,kangiossetsignalomhvilkenveidetbærer: Den nye legen baserer seg på kvalitetsmål og retningslinjer utviklet av kliniske forskerteam, med rom for klinisk skjønn der det er nødvendig. Det sentrale er etterretteligheten (accountability), det vil si alltid å kunne dokumentere hva som gjøres og hvorfor. Jo mer man fraviker fra det som er standard prosedyre, desto viktigereblirdetådokumentere.detlukkederomstiderforbi.(...) Man kan si at profesjonaliteten blir gjenfødt gjennom å imøtekomme kjøpernes krav om kunnskapsbaserte prosedyrer og bedre resultater. Forskerteam ledet av 26

27 leger, akademiske sentre og spesialistforeninger er nå opptatt av å finne hvilke intervensjonerogprotokollersomermesteffektive.(light&aasland,2003) Vissterdetromforskjønn, derdeternødvendig.mennårerdetnødvendig?ognår gjelder standard prosedyre? Hva angår helsesektoren, har Statens helsetilsyn (2001) enklaroppfatningomdette: Erfaringenviseratstandardisertebehandlingsprogrammersomregelergyldigefor mer enn 80 prosent av pasientene de er beregnet for. De øvrige pasientene har gjernetilleggsproblemerellerspesiellebehovsomtilsieratdetrengernoemereller noeannetennstandardtilbudet.isliketilfellermådeaktuellemedarbeidernefinne framrelevantealternativer. Handlingsprogrammer kan altså ikke erstatte klinisk kompetanse. De skal heller ikke overstyre medarbeidernes kliniske skjønn, men være et hjelpemiddel til å gjennomførearbeidetpåenenkelogsikkermåte. Forsikringen i siste avsnitt er åpenbart ment å veie opp for det som står i avsnittet ovenfor. Men det spørs om en velment forsikring er nok. Feltet for det individuelle skjønnet blir nokså smalt når standardiserte behandlingsprogrammer (som omfatter alt fra prognoser og diagnoser til terapier) skal gjelde for mer enn 80 prosent av pasientene.føyervisåtiladvarselenomat:jomermanfravikerfradetsomerstandard prosedyre,destoviktigereblirdetådokumentere. liggerdetikorteneatdensomutøver etskjønnsomresultererietavvikfra standardprosedyre,tarenstorpersonligsjanse. Atmosfærenfordenansvarligeprofesjonsutøverenihelsesektorenerendret,sålangter alleenige.spørsmåleteromendringenpåsiktvilværetildetbedreellertildetverre.i artikkelen Evidensbasert psykologisk praksis (2009) viser professor i psykologi, MichaelHelgeRønnestad,tilhvordandenneprosessentarforminnenforpsykologien: Behandlingsveilederne er Helsedirektoratets instrument for å sikre at pasientene får best behandling slik Helsedirektoratet vurderer det. De er også omsetningsleddet mellom forståelser av evidensbasert praksis og profesjonell praksis. [ ] Selv om retningslinjene er ment å være en støtte i utøvelsen av det fagligeskjønnet,leggerhelsedirektoratetkraftbakrådenevedåpåpekeatomikke defagligerådenefølges,vilfagpersonenhastørreansvarforfagligbegrunnelseog børutvisestørreforsiktighetennområdenefølges.forfagpersonensommenerat kunnskapsgrunnlagetergodt,erdetteuproblematisk.forfagpersonenesommener atkunnskapsgrunnlageterutilstrekkelig,[ ]erdetteproblematisk. Med kunnskapsgrunnlaget menesherformodentligdetgrunnlagetdeaktuellerådene er basert på. Når disse rådene er direkte oppkoplet til Nasjonalt kunnskapssenter og dets systematiske kunnskapsoversikter, er vi kommet farlig nær en sitasjon der den kliniskepraksisoverstyresav forskningsbasertkunnskap (EBK). Detfinnesåpenbartmangesomhilserdenneutviklingenvelkommen,ogsommenerdet er på tide at profesjonsutøveren ansvarliggjøres. Kritikerne mot det nye systemet fremholder imidlertid at det knapt nok vil ansvarliggjøre en fagperson å frata vedkommende all skjønnsmyndighet. Tross forsikringer om det motsatte, mener de at 27

28 det her er innledet en prosess, som uvilkårlig leder i retning av økt manualisering, standardisering og instruering, med mindre individuell behandling og hensyn til hele mennesketsomenavfølgene.krigenmotineffektivitetogvilkårlighetbliretterhverten krigmotdetsubjektiveskjønnetogenmistenkeliggjøringavmennesketsdømmekraft. Presset i retning av en manualisering vil nok merkes best i fag der dette inntil nå har vært lite aktuelt. Pedagogikk og store deler av psykologi kan være typiske eksempler. Rønnestad (2009) gir mange eksempler på hvordan evidensbaserte metoder i forskningen driver frem en økt formalisering eller manualisering i psykologien, idet metoder som ikke lar seg manualisere egner seg dårlig til RCT studier og lignende statistiske undersøkelser: Det sier seg selv at det er begrenset hvilke psykologiske behandlingsformersommeningsfulltlarsegmanualisere.mednoenunntakvardethøyt strukturerte behandlingsformer som adferdsterapi og kognitiv terapi som nådde kriterieneforåværeempiriskvalidert. Slikkanevidensbaseringenbidratilåsnevre innteoriutviklingenifaget,ganskeenkeltvedatforskningenretterseginnmotmetoder sompassertilevidenskravene. Det er ikke sikkert at de tendenser vi her ser avtegne seg vil få så krasse utslag som antydet. Det finnes også mange evidenstilhengere som ser problemene, men som vil regne dem som misbruk av EBK. De vil likevel insistere på at evidensbasering er et stortgode,forsamfunnetsomforprofesjonene,ogatvihellermåmøtedeutfordringene somdenførermedsegogkommetilenrimeligavveiningavsprikendehensyn.mendet eriallefallåpenbartatevidensbaseringsometpraktisk politiskprosjektkanfremmesi ulike styrkegrader og versjoner. Grimen (2009b) mener det finnes minst fire ulike framlegg:atevidensbasertpraksisa)skalerstatteskjønn;b)atdetskalkomplimentere skjønn; c) at det skal informere skjønn; og d) at det inneber utvikling av ein ny type skjønnsutøving. Dennedebattenskalviplukkeoppmotsluttenavrapporten.Førdetmåviimidlertidse nærmerepåhvilkenkulturhistoriskogvitenskapsteoretiskkontekstevidensbevegelsen springerutav.førstmedetsliktinnblikkkanviforstådennebevegelsensegenart,noe somogsåvilgiossnoenledetråderforhvordanvibestkanhåndteredeutfordringerden stillerossoverfor. 28

29 Del2:Etvitenskapshistoriskogfilosofiskbakteppe 29

30 Kapittel3:Frasubjekttilobjekt 6 Kontekstogkausalitet En ofte gjentatt kritikk mot evidensbevegelsen er at den ikke tar tilbørlig hensyn til fenomenet kontekst. Effektstudier angår snarere det vi kaller lineær kausalitet, dvs. årsak virkningsforløp. Nå kan heller ikke kausale sammenhenger avdekkes ved RCTstudieralene.Detslikestudierderimotermentåbidramed,erågisikkerhetforatvisse virkninger(medenvissstatistisksikkerhet)følgeravvissetiltak.hvorfordetteskjer,er detikkealltidenkeltåsvarepå.generelterdetteetspørsmålforgrunnforskningen,som foregårhinsidesrct studiene,enforskningnasjonaltkunnskapssenterforhelsetjenesten ikkeserdetsomsinoppgaveåformidle.isinstrategiplanfor2005sierdedetslik: Kunnskapssenteretsrollevilsærligværeknyttettildetåevaluereogmåleogikke det å forstå mer grunnleggende mekanismer eller fortolke opplevelser og sammenhenger. KontekstforståelseermedandreordikkedetKunnskapssenteretskaldrivemed.Mende skal heller ikke befatte seg med å klarlegge kausale sammenhenger ( grunnleggende mekanismer ). De skal oppsummere resultatet av effektstudier, og gjøre anbefalinger i trådmeddette.ogdeternettoppdetensidigefokusetpåeffekter,somifølgekritikerne tendensieltgjørevidensbevegelsenblindforkontekst. Effekterfinnesoveraltdertingskjer.Menverdenkanikkederforreduserestilensum aveffekter.detvilsi:teknisksettkanvinokgjøredet,mendatildenprisenatviblir blinde for det som effekttenkningen ifølge sin natur ikke kan se. Og det er, ikke minst, meningogkontekst.menhvaerkontekstoghvordanforskervipåkontekst?vanligvis identifiserer vi konteksten til et fenomen med fenomenets omgivelser eller den sammenheng det står inne i. Visuelt er et landskap et nærliggende bilde for dette. Så lenge vi er på jordoverflaten, er vi alle alltid omgitt av et gitt landskap. Samtidig som dettelandskapet(ienvissforstand)erettogdetsammeforallesombebordet,erdet også noeannet forhverenkeltbeboer.hvertingharsinesæregnefysiskeomgivelser ogstårienunikrelasjontilandreting.dettebidrartilkontekstenskompleksitet. Etytterligerebidragkommerfradetfaktumatkontekstenikkekunbrersegutiflaten. Landskapet,betraktetsomenflate,erdelavenromligkontekst.Landskapetharogsåen relasjon til det vertikale, og dermed til polariteten mellom solens lys og varme kontra jordmørkeogjordtyngde.videreharlandskapetenkomplekstemporærdimensjon,der 6 Deler av dette kapitlet bygger på innledningsforedraget på NSH-konferansen: Forskningsbasert praksis og Praksisbasert forskning. Veier og avveier i Medisinen Oslo Oktober

31 tidenarbeidermedulikhastighetfrastedtilsted.skigarden,somstårtilnedfalls,vitner om generasjoners arbeid. Det åpne jordet vokser igjen og vil være borte i løpet av én generasjon.mendensværeflyttblokkenmidtutepåjordetharliggetheri10.000år,og hartenktåbliliggendenoentusenårtil. Endeliguttrykkerlandskapet,oghverdelavdet,enmeningsdimensjon.Hvertelementi landskapet fremviser visse egenskaper og kvaliteter. Hva en eik er, kan vanskelig uttrykkes med noen få ord. Men eiken uttrykker det med alle sine egenskaper. Eikens egenskaper danner en egen kontekst som kommer til syne innenfor den romlige og temporære konteksten. Polariteten mellom lys og mørke, nevnt ovenfor, er et annet eksempel.denerknyttettildenvertikaledimensjonogaltsåtildetromlige.mendeneri segselvingenromligstørrelse;denhørertildeegenskaperogkvalitetersomvisersegi romogtid.detsomdannerdenmeningsfullesammenhengenmellomtingene,somsåå si utfyller tid og rom med mening og innhold, kan kalles en meningskontekst. 7 Ordet mening er da ikke brukt i subjektiv forstand (som opinion ), men i objektiv forstand (som meaning ),dvs.det som uttrykkes.meninguttrykkesgenereltvedogsomtingenes egenskaper og kvaliteter. Å kunne uttrykke mening verbalt, er en spesiell menneskelig ferdighet. Allerededisseantydningerviseratkonteksteretuhyrekomplekstfenomen.Åsiatdet handleromfenomenersomgivelserogdenettverkdedeltari,erentilnærming.mendet erogsåenforenkling.tendensieltisolererdetnemligfenomenetfrakonteksten,somom det selv ikke var en del av konteksten. Men tar vi eksemplet med en organisme i et økosystem,erorganismensometorganiøkosystemet.samtidigerdenmedoggirdet sittsærpreg.sliksomhverorganismeuttrykkernoeavøkosystemetsegenart,uttrykker ogsådetteegenartentilsineorganismer. Den kontekst som her er antydet, manifesterer seg på flere måter; som økosystemets interaktivenettverkavrelasjoner,menogsåsomdenmeningdissesammenuttrykkerog somgirøkosystemetetbestemtsærpreg.ietøkosystemerforholdetmellomhelhetog del aldri kun eksternt eller romlig; det er både eksternt og internt, romlig og meningsfullt.deterdettedobbeltforholdetvibenevnersomorganisk. 7 Det er det Gregory Bateson (1985) kaller the pattern that connects. 31

32 Nårdetgjelderforholdetmellomhelhetogdel,ersosialeogkulturellekonteksterikke særlig annerledes enn økosystemer. Vi preges av dem, og vi bidrar hver for oss til å pregedem.viuttrykkernoeavderesegenart,ogdespeilervåregenartsommennesker avenvisstidogkultur.enlineærårsak virkningskjedeeridennesammenhengalltidet utsnittavetstørrenettverk.åsebortfradetteeråbegåenutilbørligreduksjonisme.!'+-.)$-&'($-/.%$.0 -./+*+,%01$213'+*+,4"!"#$"%&'()%"(*+,!" #$%&'"(")*$'+*+," Figur5:Detkausaleeralltidendelmengdeavdetkontekstuelle. Atlineærekausalforklaringerkangienfullstendigogdekkendebeskrivelseavnaturen, var kongstanken for en av sannsynlighetsteoriens grunnleggere: Pierre Simon Laplace ( ). I dag er det få naturvitere som forsvarer denne tanken. Kaosteorien har påvistbetydningenavinfinitesimalevarianseriinitialbetingelsene.kvantefysikkenhar påvistindeterminerteprosesserimateriensminstedeler.denfundamentalekarakteren av kontekst, er blitt oppdaget i store deler av naturvitenskapen. Økologien er allerede nevntsometeksempel.meroverraskendeformangeerdetåoppdageatkontekstogså erblittetsentralttemaiden hardeste delavbiovitenskapen,molekylærbiologien.på 1960 og70 talletblemolekylærbiologiens gener oppfattetsomerterienpose(bean BagGenetics):HvertDNA genkoderforetprotein,somigjenbestemmeretfenotypisk trekk.sidenenorganisme(iprinsippet)varliksummenavallesinefenotypisketrekk, bledengendeterministiskemodellen(kaltdetsentraledogmet)heltenkeltslik: DNA>RNA>PROTEIN> >ORGANISME Slagordet var: Genene determinerer, mens miljøet modifiserer. Veien mellom protein og organisme(detreprikkene)varriktignokfortsattetproblem.menfåforskereinnenfor feltetvardengangitvilomatdetkunvarettidsspørsmålførenkunnegjøreredefor hvordan proteinerbyggerorganismer.dethåpetskullevisesegåværeliketroverdig somomnoenskullefortelledegatviførellersidenvilfinneutavhvordanmursteiner byggerhus,hvordandebestemmerrominndelingogdesignosv.ikkedestomindrehar 32

33 vi kunnet lese slike trosbekjennelser i lærebøkene, helt frem til nylig. Her et eksempel fraendrøyt20årgammelnaturfagslærebokforvg1,dagen reduksjonismenennåvar ungogblåøyd: Egenskapenetildeulikecelleneerbestemtavdeproteinerdeinneholder.Deulike celletypene har mange proteiner felles. Men hver celletype inneholder i tillegg spesielle proteiner, som er særegne for dem. Proteinene bestemmer hvordan celleneskalbyggeoppvevogorganer,ogavgjørisisteinstanshvordanorganismen skalseut.dettegjelderogsådeg.(jerstadet.al,1989:146) Det er først i løpet av de siste årtiene at kompleksiteten i cellens biokjemiske samspill virkelig er blitt avdekket. Vi vet nå at et DNA gen kan gi opphav til tusenvis av ulike proteinervedatkodenendresettertranskripsjon(bl.a.vedsåkaltalternativesplicing). Vi vet også at det i cellens biokjemi alltid er et nettverk av faktorer som påvirker hverandresamtidig,ogatlineærekausalkjederalltiderutsnittavdettenettverket. IstedetforåtenkeossforbindelsenmellomDNAogcellensomenlineærkausalkjede, måvialtsåtaibrukbildetavetnettverk,álanettverksrelasjoneneietøkosystem.det betyratviprinsipieltikkekanbeskriveorganismenfullstendigikausaletermer,heller ikkepåmolekylærtnivå. Figur6:Detgamleogdetnyegensynet.EtterHo,2003. Atvissefenomenerikkekankausalforklares,erimidlertidingeninvitttilirrasjonalitet, ogdetbetyrikkeatdemåforbliuforståelige.forklaringogforståelseerikkesammesak. Og som figur 6 viser, er det sentrale dogmets kausalkjede der fortsatt. Men vi ser den ikkelengerisolertfraaltdetsomforegårrundt.dermedbliraltsnakkom årsaker litt mindrenaivtoglangtmerforbeholdent. 33

34 Deteralleredeklartatkausalitetogeffekttenkningerutilstrekkeligehjelpemidlertilå håndterekontekst,ibegrepetsogfenomenetsvideogdypebetydning.menhvordangår visåfrem,omvivilnærmeossdetpåenvitenskapeligmåte?hvaerdenvitenskapelige metoden for å studere kontekst? Og hvorfor tenderer evidensbevegelsen, i det minste etterkritikernesoppfatning,tilåneglisjerekontekst?foråsvarepådissespørsmålene må vi se på hvordan vitenskapen selv har utviklet seg, spesielt med tanke på skismaet mellomkausalitetogkontekstsomførendetilnærmingsmåter.dettemuliggjørogsåen forståelseavevidensbevegelsen,somdelavenviderekulturhistorisksammenheng. Detokulturer 1959varetmerkeårforvitenskapsteorien.Dabledetsattlyspåetproblem,somhadde vært der lenge uten å få særlig oppmerksomhet. Problemet var og er, enkelt sagt, at vitenskapenersplittetitokulturer,somikkesnakkersammespråk,jasomendogserpå hverandremedenblandingavfryktogforakt.ogjevntovervetlitteraturviterenmindre omtermodynamikkens2.lovennfysikerenvetomhamlet. DetvardenbritiskefysikerogforfatterCharlesPercySnow( )somgavdenne diagnosenisinnåberømteredeforelesning.sidenharuttrykket thetwocultures vært endelavdetfasteinventaretivitenskapsteorien.visnakkerjofortsattom vitenskap og forskning somomdetdreiersegoménkultur.menvitenskapsteoretikereharlenge visst bedre, nemlig at det er snakk om en samling subkulturer, hver med sine egne teorier,metoder,idealerogstandarderforforskningen.deharogsålengevisstatdisse subkulturene grovt sett deler seg i to grupper, som på engelsk kalles Science (eller NaturalScience)og TheHumanities. 8 Pånorskkanvisinaturvitenskapoghumaniora. Snow så i og for seg ingen vitenskapsteoretiske problemer med denne todelingen. For hamvarproblemetførstogfremstavsosialogkulturellkarakter.detvarrettogslettet spørsmål om å begynne å interessere seg for de andres kultur, og skaffe seg et minimumavkulturellogvitenskapeligdannelse.menerdetvirkeligsåenkelt? Laossførstsepånoensentraletendenseridetokulturene,f.eks.hvordandetilnærmer seg fenomener de skal utforske. En forsker stusser over et merkverdig mønster i en bergvegg.medhvilketblikkvilhansepådettemønsteret?detavhengeravomhaner arkeolog eller geolog. Arkeologen etterspør mening: Er det en tekst? Er det magiske tegn? Hva betyr de? Geologen ser etter den mekaniske årsaken: Er det erosjon? Bevegelser i jordskorpen? Isbreskuring? De dominerende tendensene er skissert nærmereitabellennedenfor. 8 Snow snakket om scientists kontra literary intellectuals, men den siste gruppen ble etter hvert utvidet til å omfatte alle akademikere utenom det naturvitenskapelige felt. 34

35 NATURVITENSKAP Kausalitet (Årsak>Virkning) HUMANIORA Finalitet&Mening (Hensikt) Søkerforklaring (Lineærmodell) Analyse(reduksjonistisk) Søkerforståelse (Bredde/kontekst) Syntese(holistisk) Kvantiteter/empiriskedata Kvaliteter/meningsuttrykk Formalekriterier (Hypotetisk deduktiv metode,statistikk,etc.) Objektivisme(positivisme) Tolkning (Utfraforhåndskunnskaperogkategorier) Intersubjektivisme(konstruktivisme) Tabell2:Dominerendetendenserinnenfordetokulturer. Naturvitenskapenforholdersegaltsåtildetromligeogstoffligeogetterspørkausalitet, menshumanioraforholdersegtilbevissthetogkulturogetterspørmeningoghensikt. Oghvaersåproblemet?Erikkedetteenheltnaturligoggreiarbeidsfordeling? Dersomverdenvarskarptoppdeltpådennedualistiskemåten,villealt kanskje være helt greit. Og Snow ville ha rett: Det er bare snakk om å utvikle en krysskulturell dannelse,såerviimål.menverdenerdessverre ellerheldigvis ikkeskarptoppdelt på denne måten. Det oppdager vi straks vi spør: Hvor hører levende organismer hjemme? Hva med oss mennesket? Hører vi til på den naturvitenskapelige eller den humanistiskesiden?vikommerikkeutenomdetfaktumatvierintegrertehelheterav stoff, liv og bevissthet. Dette er et faktum uansett hvordan denne integrasjonen måtte finnested.grensenmellomdetokulturergåraltsåmidtgjennomhverdelavmennesket ogderforogsåmidtgjennomhverdelavf.eks.biologiogmedisin. Siden mennesket er et kronisk psykosomatisk fenomen, holder det ikke å si: Soma til naturvitenskapenogpsykentilhumaniora.spørsmåleter:hvorfinnervidenvitenskapen sombetrakterogbehandlersometheledetsomforeliggersomethele? Positivismeogkonstruktivisme Åsnakkeomkarakteristiskeellerdominerendetendenseridetokulturer,kanskapedet inntrykkatviharmedtojevnbyrdigestørrelserågjøre.mendeterlangtfratilfelle.ser vipåheleden400 årigeperioden,fragjennombruddetavdennyeretidsvitenskaptili dag,erdetlitentvilomhvilkenvitenskapskultursomharværtdenførende.humanioras 35

36 krav på metodologisk autonomi overfor naturvitenskapen kom sent, og har aldri vært uomstridt.ogmenshumaniorailitengradharmaktetåinvaderenaturvitenskapenmed sineforskningsidealer,harinvasjonenedenandreveienkommetistadignyebølger. Atgrensedragningenmellomdetokulturerfortsattikkeeroppogavgjort,kanvistadig få bekreftet. Høsten 2008 hadde Klassekampen et oppslag om en opprivende internkonfliktvedinstituttforstatsvitenskap,uio.herheterdetblantannetat: Ved instituttet har det særlig vært konflikt mellom to grupperinger. På den ene sidenforskeresominntarenpositivistiskholdning,ogmenersamfunnetskalkunne studeresetternaturvitenskapeligepremisser.pådenandresidenkonstruktivistisk orienterte forskere som framhever at vår fortolkning av verden er avhengig av forhåndskategorisering. 9 En representant for den første grupperingen, professor Raino Malnes, bekrefter i intervjuet sitt syn på at samfunnsvitenskap og andre humanvitenskaper i bunn og grunnermakentilnaturvitenskapene.hansantagonist,professorjeffreycheckel,har omsiderfåttnokav dettebakstreverskevitenskapssynet,somhanmeneraltforlenge har fått lov til å prege instituttets virksomhet. Han har derfor funnet seg en annen arbeidsplass. Eksemplet kan tjene til å illustrere det forhold at de ideologiserte versjoner av de to kulturene,positivismenogkonstruktivismen,alleredeharlagtbaksegforestillingenom engreiarbeidsfordeling.hersnakkerviomgrunnleggendemotsattesynpåvitenskap og forskning, syn som begge ønsker skal prege all vitenskap. Da blir det naturlig nok kamppåkniven. Idesiste10 20århardetværtensterknypositivistisktrend,somerblittmarkedsført (ellerutskjelt)underulikenavn,altfraåbliidentifisertsom vitenskap (rettogslett)til å bli kalt biologisme. Hvordan positivistiske strømninger er på offensiven innenfor samfunns og sosialvitenskapene, så vi våren 2010 et nytt eksempel på under Harald EiasNRK serie Hjernevask.Dettabloidespørsmåletsomlåibunnvar:Fødtsånneller blittsånn?ogprogramserienlaopptilåoverbeviseossomatvi stortsett er født sånn. Den seneste positivismetrenden innebærer ingen prinsipiell nyhet, men er et ledd i en serie pendelutslag, som har pågått i over 150 år. Som en definert idéstrømning går positivismen tilbake til midten av 1800 tallet, da naturvitenskapen ble et ideal for all forskning. Sentrale tenkere her var Auguste Comte ( ) og John Stuart Mill ( ).Comteregnes,vedsidenavåværeenavpositivismensfedre,ogsåsomen av sosiologiens grunnleggere. For så vidt kan man godt si at positivismen oppsto 9 Klassekampen : Kritiserer UiO-fagmiljø. 36

37 innenforhumaniora,baremanhuskeråtilføyeatdensmodellerogidealerstammerfra naturvitenskapen. Snartbegynteimidlertidendelhumanistiskeforskereogfilosoferåsettesegoppimot dennetenkningen,oghevdehumaniorasmetodiskeautonomioverfornaturvitenskapen. Hermeneutikeren Wilhelm Dilthey( ) fremhevet at meningsfulle fenomener, som språk og historie, først og fremst må forstås. Årsaksforklaringer er her helt underordnet.entekstinviterertillesningogtolkning.tekstensinnholderlikeskjultfor ossomviutforskerhvilketinstrumentsomharformettegnenepåarket. Dennemotreaksjonenmotpositivismenskravomårepresentere helevitenskapen,var isinturforegrepetavromantikkensreaksjonmotdetmekanistiskeverdensbildet.dag Østerberg(1994)trekkertrådenehelttilbaketilmidtenav1700 tallet: Det mekanistiske verdensbildet utfordres for alvor etter 1750, og aller først av GiambattistaVico.VicoerenslagskulturvitenskapenesDescartes,fordihanstiller oppmedet motprinsipp tildescartes,nemligathistorienerlettereåkjennefor oss enn Naturen, fordi historien er menneskeverk, mens Naturen er Guds skaperverk. Vico vil grunnlegge en scienza nuova, en ny vitenskap om historien, men mislykkes fullstendig i å reise selve tankebygningen. Cassirer tillegger av denne grunn Gottfried Herders verk større betydning. Herder ( ) er en tidlig romantiker som gjør opprør mot fornuftens tyranni. Han vil vise at det finnes objektivitet og orden også utenfor den matematiske fysikkens og materiens område. Et kosmos, en objektiv orden og bestemthet er tilstede overalt hvor forskjellige subjekter forholder seg til en felles verden Et slikt fellesskap er språket språkfellesskapet og forståelsen er grunnleggende; naturvitenskapelig språk og fornuft er bare én av mange språkformer, som konstituerer forskjellige områder av virkeligheten. Den historievitenskap Herder ser for seg, utfolder alle former for mening poesiens og mytens likeså vel som fysikkens. Dermed er grunnen beredt for kulturvitenskapenes oppståen. I romantikkens tidsalderoppstårenselvstendigspråkvitenskap,kunstvitenskap,religionsvitenskap ved siden av naturvitenskapene. Skillet mellom realfag og humaniora vinner innpass, et skille som etter hvert utvikler seg til gjensidig fremmedhet, ja, iblant fiendtlighet. Denne utviklingen forsterkes som nevnt mot slutten av 1800 tallet. Som antydet ville detimidlertidværeenoverdrivelseåhevdeatkulturvitenskapeneidetstoreogheleble dominert av romantikkens idealer og Dilthey tradisjonen. Det er mer presist å snakke omendominerendemotstrømmotdenpositivistiskehovedstrømmen.historikerentore Nordenstam(2000:104)karakteriserersituasjonenslik: Den typiske holdningen på humaniora området fra slutten av 1800 tallet og langt innivårtegetårhundreerdetsomerblittkalt denpositivistiskehistorismen og som like gjerne kunne kalles den historiske positivismen. [ ] Kjernen i den historiske positivismen er forestillingen om at den naturvitenskapelige erkjennelsesmåteneretmønsterforallkunnskapsdannelseoverhodet. Situasjonenlignerdenvifikkpåsluttenav1900 talletogrundtårtusenskiftet.etteren intens50 årigpositivismestrid,derpositivismekritikernevaroverlegenialleteoretiske 37

38 spørsmål,bleendringeneidenvitenskapeligepraksishellersmåogoverfladiske.etter manges mening ble positivismestriden en kamp som kritikerne vant i auditoriene og tapteoveraltellers.ialletilfellerkanviidagfastslåatpositivismenutkommeristadig nyeversjonerogblomstrersomaldrifør,mensdenskritikerefortsetteråskrivetykke bøkerogskarpsindigeartikler. Ensentralgrunntilpositivismekritikkensmaktløshet,eratdennyeretidsvitenskapble oppfattet som kilden til en formidabel teknologiutvikling, som har vært regnet som et udeltgodeognærmestetsynonymforsamfunnsutvikling.dennyeretidsvitenskapblei altvesentligenteknovitenskap,somhaddedominansovernaturenøverstpåagendaen. Dettegav(ihvertfallinntilnylig)positivismenenlegitimitet,somgrunnmurfordenne teknovitenskapen. Når vi snakker om de to kulturer i vitenskapen, må vi altså ikke glemme at den ene av de to, den galileisk baconianske newtonianske naturvitenskapen, harværtledende(paradigmatisk)i400 år. På1920 talletdukketdetoppennypositivistiskstrømningidensåkaltewienerkretsen. Denneretningen,sombleledetavfilosofenMortizSchlick( ),kalteseglogisk empirisme. De fordømte alt som metafysikk som ikke holdt seg strengt til det de definerte som empiriske sannheter. Fra midten av 1930 tallet begynte på nytt en lengreperiodeavpositivismekritikk(jf.tabell3),somtoppetsegpå1960 og70 tallet og først ebbet ut med postmodernismen et stykke inn på 1990 tallet. Deretter gikk vi, somnevnt,inniendaenrundemednypositivisme. Positivismestriden Hva kan vi lære av den historiske dialektikken, som disse pendelutslagene er uttrykk for? Den 50 årige perioden med positivismekritikk har gitt oss en rekke innsikter som fortsatt er gyldige, men som lett glemmes under et nypositivistisk regime. Noen av de sentralebidragenetil1900 talletspositivismekritikkerlistetoppitabell3.oversikten erlangtfrakomplett,mendenfremhevernoenmilepeleridenneutviklingen,somvelå merkealdrivarnoenenhetlig langtmindreorganisert bevegelse. 38

39 Positivismekritikken Forfatter KarlPopper OwenBarfield N.R.Hanson H.G.Gadamer ThomasKuhn MichelFoucault PaulFeyerabend NelsonGoodman Jean Fr.Lyotard År(førsteutgave)&Bok 1934:DieLogikderForschung 1957:SavingtheAppearances 1958:PatternsofDiscovery 1960:TruthandMethod 1962:TheStructureofScientificRevolutions 1968:TheOrderofThings 1975:AgainstMethod OutlineofanAnarchisticTheoryofKnowledge 1978:WaysofWorldmaking 1979:ThePostmodernCondition Tabell3:Sentralebidragtil1900 talletspositivismekritikk. Idenneoversiktenerkuninternasjonaltkjentebidragtattmed.Skullevinevneetnorsk bidrag, som ble epokegjørende her til lands, måtte det bli filosofen Hans Skjervheim. I sinmagistergradsavhandling Objectivismandthestudyofman (1959)foretarhanen dyptgående kritikk av objektivismen i studiet av mennesket. Både i denne boken, som kom ut på Gyldendal i 1974, og i senere skrifter bidro Skjervheim sterkt til å hevde humaniorasselvstendigemetodologioverforenekspansjonshungrigpositivisme. Et sentralt poeng i positivismekritikken er den naive selvforglemmelsen, som ligger i forestillingen om objektivitet, som en kontekstfri og verdinøytral kunnskap. En slik forestilling tenderer mot å usynliggjøre forskerens kontekst og verdibaserte valg og vurderinger.isisteinstansblirforskerensvalgogvurderingernærmestsomenfeilkilde åregne.jomindrevurdering,dessbedreforskning. Mendetteeråoversedenimplisittehermeneutiskekomponenteniallforskning,ogsåi den harde naturvitenskapen. Uansett hvor nøyaktige målingene er, må det være en grunntilatnettoppdissemålingeneerrelevante.oggrunnenkanbaregisgjennomen kontekstbasert vurdering, som forskeren selv må stå inne for. Grunnleggeren av den filosofiskehermeneutikken,hans GeorgGadamer(2004),sierdetslik: Heller ikke i naturvitenskapen er det som kalles fakta tilfeldige målinger, men målingersomrepresentereretsvarpåetspørsmål,enbekreftelseelleravkreftelse på en hypotese. Slik er heller ikke et forsøk på å måle bestemte kvantiteter 39

40 legitimertveddetfaktumatdissemålingeneergjortmeddenstørstenøyaktighet, ifølge alle regler. Målingen oppnår sin legitimitet bare gjennom forskningens kontekst. Slikinvolvererallvitenskapenhermeneutiskkomponent.Sliketspørsmålelleret faktum ikke kan betraktes i isolasjon innenfor det historiske felt, er det samme tilfellefornaturvitenskapen. Objektiviteteraldrinoerenteksternt,ogdrømmenomenfullformalisertvitenskaper enillusjon.uttrykksom objektivemålinger og objektiveinstrumenter maskererdet forhold at all observasjon er teoriladet, allerede ut fra bestemmelsen om hva som skal observeres. Vitenskapsteoretikeren Karl Popper skal ifølge en kjent anekdote ha illustrert dette poenget ved å innlede en forelesning med følgende beskjed til sine studenter: Ta frem blokk og blyant. Nå får dere 5 minutter, der dere skal observere nøyeognoterenedaltdetdereobserverer.derekanstartenå! Minuttenesnegletseg avsted.studentenesårådvillepåhverandre.ingennotertenoesomhelst.tilsluttkom en modig hånd i været: Unnskyld, Hr. professor. Men hva var det vi skulle notere? Popperreplisertestraks: Gratulerer!Duharoppdagetpoenget! Alldatainnsamlingskjeraltsåilysavengittkontekstforståelseogerledetavenbestemt teoretiskinteresse.verdenerfullavfakta,ogvimåhavissekriterierforåavgjørehvilke som er relevante og interessante. Og idet vi velger ut visse fakta som relevante og interessanteharvisamtidigvalgtvekkmangeandrefaktasomkunneværtinteressante ogrelevanteilysavenannenteori,etannetperspektivogenannenkontekstforståelse. Våreteorierogfagligeperspektivererigjenkunenlitendelavdetsomkonstruktivister forbinder med begrepet forhåndskategorisering. De kategorier som ligger i språk og kulturutgjørenstørreogmerfundamentaldel. Men kritikken gikk også dypere enn dette. Allerede før Popper hadde fenomenologien, grunnlagtavfranzbrentano( )ogEdmundHusserl( ),fremhevet at alle våre persepsjoner er intensjonale. Det er ikke bare slik at våre vitenskapelige observasjoner er ledet av en teoretisk interesse og kontekstforståelse. Men noe tilsvarendegjelderendogforelementærepersepsjoner:allpersepsjonerbegrepsformet. Vi ser ikke bare med vårt fysiske øye, vi ser også samtidig med vår innsikt og våre forkunnskaper. Den britiske filosofen og språkforskeren Owen Barfield (1965) sier det slik i sitt hovedverk,savingtheappearances: jeg persiperer ingen ting med mine sanseorganer alene, men med en stor del av helemittmenneskevesen.jegkanf.eks.siløstatjeg hørerentrostsynge.menalt hvajegnoensinneblott hører altsomjegnoensinnehørerikraftatjegharører erstrengttattlyd.nårjeg hørerentrostsynge,hørerjegikkemedørenealene, men med alle slags andre ting som mentale vaner, hukommelse, forestillingsevne, følelseogvilje. 40

41 Hørervimedviljen?Allevethvordanviietselskap medenkakofoniavstemmer kan skilleuténenkeltstemme(f.eks.nårvihørervårtegetnavnblinevnt)ogbarelyttetil denne. Å lytte eller se krever selektiv oppmerksomhet, og er for så vidt en viljesakt. Straks vi slutter å lytte med intensjonal oppmerksomhet, blir verden stum. Straks vi slutteråsemedintensjonaloppmerksomhet,stirrerviblindt. Figurering Figurering kaltebarfielddetsomgjørossistandtilåpersiperetingsombestemteting, ogdermedskilledemutfradetubestemtebakgrunnskaos.nårjegseretbord,serjegdet som bord. Og denne bestemmelsen bord er en kognitiv prestasjon. I mørket vil vi kanskje gjøre en annen og foreløpig bestemmelse, idet vi støter borti noe vi tror er en kommode.såslårvipålysetogseratdeteretbord.menselvnårlyseterslåttpåkanvi fortsettemedåfigurerebordetpåstadignyemåter.erdetetslittogutrangerttrebord, kanvibegynneåsedetsom ved.erdetetantiktbord,kanvibegynneåsedetsomet kunstuttrykk,f.eks.somet rokokkomøbel.ellervikansedetsomendelavetinteriør, osv.språkforskerenmichaeltomasello(2009)fremheverat: Mennesker er de eneste vesener på denne planeten som kan begripe verden på basisavulikepotensielleperspektiverpåenogsammegjenstand. Hvadameddyr?Ogsådyrfigurererverdenpåbasisavvissekognitivekategorier.Disse harimidlertidikkesammefleksibilitetsomhosmennesket.nårviseretlam,kanvifor eksempel se det som pattedyr, som ullprodusent, som bildet av uskyld eller som middagsmat.detavhengeravomvierbiolog,bonde,prestellerkokk.menselvomvi hører til det ene eller det andre fag eller yrke, er vi som regel ikke så fanget av fagets perspektivatvieruteavstandtilåforståoginntaandreperspektiver.ulvenharikkede sammevalgmuligheter.denersliksettenfagidiot,somikkevilhalettforåselammet som bildetavuskyld. BiologenErnst MichaelKranich(2004)nevnerpaddensometeksempelpåenekstrem fagidiot: Man har slått fast at de fleste padder kun ser det som beveger seg, altså det som eventuelterspiselig.ubevegeligegjenstander,ogdetsomiøyeblikketikkebeveger seg,ansporerikkesynssansen. Forpaddeneraltsåtingsomikkekanspises,ellertingsomikkekanspiseden,temmelig uinteressante.ogdaerdetjolikegreitatdeikkeforstyrrerpersepsjonsfeltet.avogtil kanvistøtepåslikepadderogsåinnenforvitenskapen,forskeresomharmistetevnentil åsedetsom ikkeharinteresse utfraderessnevrefagperspektiv. Detintensjonalevedvårepersepsjonergjeldervelåmerkeikkebaretolkningenavdetvi ser, men også det vi faktisk ser: Tolkningen ligger innebygd i persepsjonen. Vi sier jo 41

42 gjerneatvitrordetikkeførviserdet.menfaktumeratviserdethellerikkeførvi tror det, eller altså innser det. Innenfor persepsjons og kognisjonsforskningen finner vi mangeklassiskeeksemplerpådette.ettavdemestkjenteerneckerskube: Figur7:Neckerskubetillatertreulikeperseptuelletolkninger. Vikansefigur7påtremåter:Somet2D mønsteravlinjer,ellersometbildeavenkube (3D).Idetsistetilfelletharviigjentopersepsjonsmuligheter.Dissekanantydesvedåsi atdennederstelinjenkanværeendelavkvadratetlengstbortefraossellerdetsomer nærmestoss.ogdetteerjoingenlitenforskjell! Nåviljodeflesteavossværeistandtilåfortadennegestalt svitsjen,somdenkalles.vi innserogsåatdetprinsipieltikkeernoengrunntilågiforrangtilettavdealternative syn på saken. Men la oss si at hver persepsjonsmulighet sto for et bestemt faktum, som f.eks. kunne være avgjørende for vurderingen av en bestemt terapi. Om et gitt forskersamfunnvaruteavstandtilåforetaenslikgestalt svitsj,villeviklartfåinnen vinkling(bias)iforskningen.synetpåplacebo somenfeilkildeellersomenressurs melderseghersometnærliggendeeksempel. Etanneteksempelpåenslikgestalt svitsjellerpersepsjonstolkning,ervistifigur8: Figur8:Andellerhare? 42

43 Åse and eller hare eringenuvesentligforskjell.forskjellenmellomåseplacebosom feilkilde eller som ressurs er heller ikke uvesentlig, hverken for legen eller for pasienten.likedankandetværeenfruktbargestalt svitsjåvekslemellomåseuroien klassesometproblemmed bråketegutter ogsometproblemmed undervisningsom ikke appellerer til gutter. En RCT studie som kun så problemet på den første måten, kunne komme ut med en klar evidens for at bråk i klassen øker med andel gutter i klassen.engestalts svitsjkunnegigrunnlagforandrespørsmål,somkunnegiopphav tilandreundersøkelsermedevidensforandrerelasjoner. Togrøfterogveienmellom Positivismekritikkenharaltsåvistat allobservasjonerteori ogkontekstavhengig,ogat allpersepsjonsamtidigerenkognitivprestasjon,hvilketinnebærerat allpersepsjonerperspektivisk,ikkebareromligsett,menogsåkognitivt Gittdenneinnsiktenerdetlettåtrekkeenforhastetkonklusjon,nemligat detfinnesingenobjektivforskning,siden allforskningerinfisertavdensubjektivitetsomstammerfra våreindividuelleogkulturelleforhåndskategorier Detvardaogsådennekonklusjonensomoftebletrukket.Dendannetenviktiggrunntil densubjektivismeogrelativismesomharpregethumaniora,iformavkonstruktivisme ogpostmodernisme.oftegikkdetsålangtatenbenektetatkjønn,funksjonshemninger, lærevansker,osv.varnoemerennsosialekonstruksjoner.motpartenvarpåsinsidelite innstiltpååkrediterekonstruktivistenefordeninnsiktenatdissefenomeneneogsåer sosialekonstruksjoner. Toneangivende i 1960 og 70 tallets bølge av konstruktivisme, ble særlig franske sosiologerogfilosofer,sompierrebourdieuogmichelfoucault.fordemervitenskapen ingen leverandør av objektive sannheter. Vitenskapen består derimot av en rekke diskurser, dvs. institusjonaliserte prosedyrer for akademisk adferd. Disse prosedyrene er vesentlig historisk og kulturelt betinget, og de styrer forskningens hva og hvordan. Forskeren subjektet erutleverttildissediskursene,pånådeogunåde.forfoucault er subjektets bevissthet generelt skapt av slike diskurser. All kunnskap er relativ i forhold til den diskurs den oppstår i. Og de dominerende diskurser er vesentlig teknikkerforåutøvemaktogkontroll. Etterenkortoghektiskblomstringkjørtedensterkekonstruktivismensegfast,allsin skarpsindighet til tross, i den klassiske blindgaten som heter selvreferanseproblemet. 43

44 Hvis all kunnskap er uttrykk for makt eller interesser, må dette også gjelde for dette utsagnet.vikanialletilfellerikkeoppfattedetsomuttrykkforenobjektivinnsikt. Atdensterkekonstruktivismenmøttedenlogiskeveggen,betødimidlertidikkeslutten forallkonstruktivisme,ogslettikkeenbileggelseavkonfliktenmellomdetokulturer. Det finnes mer sofistikerte utgaver av konstruktivismen enn Foucaults versjon. I et intervju i Morgenbladet høsten 2009, blir fremtredende representanter for de to kulturer spurt om splittelsen fortsatt består. Sosialantropolog Iver B. Neumann ser ingenvendingbortfrakonstruktivistiskemodellerisittfag,som harværtdominertav konstruktivismefrabegynnelsen,ogfortsatterdet.dago.hessen(biolog)bevitnerpå sin side at biologien applauderer en større vektlegging av empirisk kunnskap eller positivempirisme. 10 Enhversomkjennerdetteterrengetkanbekreftederesutsagn. Positivismekritikkens kjerne var berettiget. Men en epistemologisk subjektivisme, som skissertovenfor,varogeringennødvendigkonsekvens.foreksempelerdetfaktumat allvårerkjennelseerperspektiviskikketilhinderforatvikanhaobjektivefenomener forøye.j.w.vongoethe(1833)sierienaforisme: Kjennerjegmittforholdtilmegselvogtilutenverdenen,såkallerjegdetsannhet. Slikkanenhverhasinegensannhetogdeterlikevelalltiddensamme. 11 Eksempel:Jegserettretversoveråkerenderborte.Aldriførharnoensettdettetreet pådennedagen,franøyaktigdenneposisjonen(20,41cmbakdennesteinenog1,78cm rettopp),meddisseøynene.sålangterdetaltså minsannhet.mensamtidigkanjegse atdetsomstårderbortefaktiskerett r e,jadeterutvilsomtetg r a n t r e.skjøntdustår pådenandresidenavtreet,ogserdetfradittunikeperspektiv,erdetteenerkjennelse som gjelder for oss begge.dette betyr ikke at vi ignorerer det faktum at begrepet tre må konstrueres, lik ethvert annet begrep. Men denne konstruksjonen kan ikke lykkes med mindre den har et objekt for begrepet. Og dersom objektet tillater det, dvs. er innholdsrikt nok, vil hver enkelt (og hver enkelt tid!) gi disse konstruksjonene (begrepene) sitt individuelle preg. Vi kan altså ha hvert vårt perspektiv på det samme objektivefenomenet,ogdetteperspektivetkanselvværeendelaverkjennelsesinnholdet. Detsomgjelderforvåreoptiskeperspektiver,gjeldernåtilsvarendeforvårekognitive perspektiver og sosiale konstruksjoner. Visst kan vi oppdage et vårt begrep tre er pregetavvårtidogkultur.vikanf.eks.oppdageatdetfinnes(fantes)kulturersomikke ser(så)påethverttresom enlevendetingutenbevissthet,slikvigjør.blantnaturfolk hardetf.eks.værtenvanligoppfatningattrærkanværebeboddavendeva( treånd ). 10 Morgenbladet nr , ( ): Skjer det et ideologisk skifte innenfor ditt fag? Ser vi en vending bort fra konstruktivistiske modeller? 11 Kenne ich mein Verhältnis zu mir selbst und zur Außenwelt, so heiß ich s Wahrheit. Und so kann jeder seine eigene Wahrheit haben, und es ist doch immer dieselbige. 44

45 Trærogtrærblirdafordemhøystuliketing,påsammevissomvigjøretfundamentalt skillemellomlevendekropperoglik,selvomdetnoenganger(forenraskinspeksjon) kanværevanskeligåseforskjellen. Blirdaikkenaturfolksbegrepetom tre etfundamentaltannetennvårt?ogmåviikke konkluderemedatvårobservasjon tre kunharrelevansinnenforvårsenmoderne diskurs? Å oppdage at det finnes andre perspektiver, lærer oss å overvinne illusjonen omennaivobjektivismeibetydningensubjekt ogperspektivfrikunnskap.mendetfører ikke derfor til en epistemologisk subjektivisme. Våre observasjoner er rett nok aldri perspektivløse, heller ikke i kognitiv forstand. Men idet (og i den grad) vi ser vårt perspektiv,somettavflereandremuligeperspektiver,overskridervidetssubjektivitet. Våre forhåndskategorier kan objektiveres (ses utenfra) og studeres på lik linje med andrefenomener.rettforståttinneholderkonstruktivismenpådennemåtenmotgiften forsinegenensidighet. Denneoppdagelsenbledaogsåuttaltunderpositivismestriden,skjøntdenblelikefort glemt,tilfordelformerekstremesynsmåter.skjervheim(1974:79)erimidlertidinnepå dettesporet.hanrefererertilenhistorieenavgestalt psykologiensfedre,kurtkoffka, fortalteforåillustrereforskjellenmellomet geografiskmiljø oget adferds miljø : For å eksemplifisere skiljet fortel han ei historie om ein mann som kjem på hesteryggen til eit vertshus ein kveld, etter at han har ride timesvis over ei snøkledd vidde, der snøen har dekt alle stiar og landemerke. Men når vertshushaldaren fortel han at han har ride tvers over Boden sjøen, fell ryttaren død om framforføtenehans. Idettetilfellet,hevdarKoffka,vardetgeografiskemiljøetBoden sjøen,menåtferdsmiljøetvaridetheileikkjeinnsjøenmedsinusikreis.detvareisnø dektvidde. Enkrasskonstruktivistvillehernikkeanerkjennende,ogtahistoriensomenbekreftelse påatvileverogtenkeriulike diskurser og sosialekonstruksjoner.teoretiskfysikk er kun adferds miljøet til en teoretisk fysiker. Men Skjervheim, den skarpeste av våre hjemlige positivismekritikere, er ikke villig til å gi denne konklusjonen det siste ordet. Hanfortsetternemligslik(s.82): Det geografiske miljøet er geografens røyndom, den fysiske verda er fysikarens røyndom,ellersagtpåeinannanmåte:denfysiskeverdaerfysikarensåtferds miljø i eigenskap av teoretisk fysikar.[ ] Men dette impliserer ikkje at der er seriar av subjektive røyndomar, den eine isolert frå den andre. Subjekta er ikkje vindaugslausemonadar,menståridialogmedeinannan. Såleisendraryttarenviharsnakkaom,sindefinisjonavsituasjonensomresultatav det vertshushaldaren fortalde han. På grunn av kommunikasjon av dette slaget leverviikkjeikvarvårprivateverd.vileverieifellesverd. Detteløserselvsagtikkemedettslagalleproblemerknyttettilskismaetmellomdeto kulturer.atvi leverieifellesverd sierjoisegselvikkemyeomhvilkenstatusvikangi 45

46 denneverden.meneksempletviseridetminsteatrelativismeogsubjektivismeikkeer ennødvendigkonsekvensavpositivismekritikken. Denekstremesubjektivismenerellersofferformangeavdesammeillusjonersomden ekstremeobjektivismen.fellestankegodserf.eks.descartes ontologiskedualisme(den tvedelteværensforståelsen),somsieratalt innioss (ivårbevissthet)ersubjektivtog atdetobjektiveernoeutenformennesket.dersomideerogbegreperkunernoesomer innihodet påsubjektet,ogikkenoesomsamtidigkangjenfinnes derute,harviingen grunn til å tro at vi kan fatte verden med våre begreper og ideer. Men som filosofen Marek Majorek(2007) påpeker, bygger denne oppfatningen på en misbruk av termen objektivitet: Det er en feiloppfatning å tro at objektivitet kan nås ved måling, matematikk og statistikkalene.deterenfeiloppfatningåtroataltsomer innvendig ersubjektivt og at det objektive kun kan nås ved å befri resultatene fra det menneskelige element.dersomdettevarsant,villedetikkeværenoenmulighetforkunnskap,for tanker somfortsatterdenødvendigebærereavallkunnskap kommerheltklart tilsyneinnimennesket.åvilleelimineremennesketfradenkognitiveprosessen foråfremmeidealetomobjektivitet vilsiåeliminerekunnskapogkognisjonidet storeoghele! Positivistens selvreferanseproblem er altså ikke mindre enn konstruktivistens. Få har settdetteproblemetsåskarptsomhansskjervheim(1992:157): I slutten av An Enquiry Concerning Human Understanding spør Hume kva slags øydeleggingarvimåfåistanddersomvierovertyddeomdeiempiriskeprinsippa hanharsettframoggrunngjeve.hanseier: Dersomvitekeitellerannabindavei bokihanda,tildømesomteologiellerskulemetafysikk,latossdåspørja:inneheld det noko abstrakt tenking om kvantitet og tal? Nei. Inneheld det nokon eksperimentelleresonnementomfaktaogeksistens?nei.kastdetdåpåelden;for detkanikkjeinnehaldanokoannaennsofistikkogillusjon. Om vi nå følgjer Hume sitt råd, viser det seg at vi ikkje berre må kasta Platon og mykjeavaristotelespåelden,menmellomaltdetandreogsåhumesitteigeverk. Positivisten, som kun vil godta ytre fakta og kvantifiseringer over disse som evidens, glemmeratdetsomdissefaktaogtalleventueltviser,alltidmåfattesbegrepsmessigog innenfor en meningsfull og kontekstuell virkelighet. Mens evidens kan angå rent kognitive fenomener, begrepsmessige og logiske forhold, kan det aldri angå rent ytre fenomenerogforholdfrakopletenkognitivkontekst.desomhargjennomskuetbeviset foratsummenavvinkleneienhvertrekant(påetideeltplan)er180,kanregnedette som et evident så vel som objektivt faktum. Det er innlysende for tanken(evident) og detgjelderalletrekanterderute(objektivt).menbeviset,somgirossevidenserfaringen, mågjennomføres innioss.vifinnerdetikke derute.ja,ermålingen nøyaktig nok, vildensnareregioss eller enn180.detobjektive allmenngyldige liggerhereneogaleneiideen. 46

47 Erfaringen av at all sansning er gjennomtrengt av begreper eller ideer, burde da også føreossforbidensubjektivistiskekonklusjonen.deterentriviellsannhetatallerfaring er infisertmedsubjektivitet,idenforstandatallerfaringersubjektetserfaring.hvavi videremåinnse,eratsubjektetkanerfaretingenesform.detfenomenetvisereralltid figurert.ideen formen hørertingentil. Nårjegserbordetsom bord,såserjegjodensammeideenutavfenomenetsomen gangblelagt innidet,somharformetdetogsomtilsluttbledetsform.hellerikkei tilfelletmedneckerskubeerdetvilkårlighvajegser.fenomenettillatermegf.eks.ikke å se en pyramide eller et skrujern. Tilsvarende med figuren and/hare, også den legger begrensningerpåhvordanjegkanfigurereden.minekognitiveprestasjonerskjeraltså ikkeutfranoensubjektivvilkårlighet,menerveiledetavdetsombefinnerseg derute. Vihardaogsåetbegrepfordettilfelletderviikkeerveiledetavetobjektivtfenomen. Detkalleshallusinasjoner. Enhverempiriskerkjennelseinnebæreretmøtemellomsubjektogobjekt,mellomden somerkjennerogdetsomerkjennes.verdenpresenterersegformeg.menhvertblikk pådenmånødvendigvisværemittblikk.ogomjegikkekjennermittståsted,meddets begrensninger,risikererjegåbliofferforenobjektivistisk(positivistisk)illusjonomat mitt synpåsaken er sakenselv.hvisjeg,pådenandresiden,ikkefulltutkaninnseat mittsynpåsakeneretsynpåsaken,blirjegofferfordensubjektivistiskefordreiningen. Idetviinnserdendialektiskenaturentilallforståelse,kanviogsåanerkjenneGadamers (2004:457) paradoksale uttrykk: Vi forfølger helt enkelt en intern nødvendighet i tingenselvnårvioverskriderideenomobjektogobjektivitetiforståelsen,ognærmer oss ideen om at subjekt og objekt hører sammen. Dette krever imidlertid en slags likevekt mellom subjekt og objekt, en situasjon som likner en real dialog der begge partertilkjennesevneogretttilåtale. 47

48 Kapittel4:Veientilverden Denkartesianskeøksen Det spørsmålet som henger igjen etter denne gjennomgangen, er hvordan vi kan finne veienmellomekstremene,objektivismeogsubjektivisme.med vi menesdabådehver enkeltavossogvårvitenskapogkultur.ogmedå finneveien,menesbådeiteoriog praksis. Også evidensbevegelsen må ses i lys av denne problematikken. Offisielt formidles den somenformutenegetinnhold.denfremmerenmetodologi,meningenontologi,iform av et bestemt menneskesyn eller natursyn.tendensielt fremstår de kunnskaper den formidlerdermedsomverdinøytraleogkontekstfrie.somvivilkommetilbaketilidel3, er dette en nokså grunn oppfatning. Heller ikke evidensbevegelsen opererer i et kulturhistorisk vakuum. Og forestillingene om at kunnskap kan være verdinøytral og kontekstfri, er signaturen for et positivistisk kunnskapssyn. Det bærer sin ontologi på ryggen,usynligfordensomstirrerstivtfremforseg. Før vi vender tilbake til dette spørsmålet, må vi imidlertid se på mulighetene for en brobygging mellom de to kulturer. Kan vi skape en kunnskapskultur, der subjektets erfaringsverdenerintegrertmedverden derute?dersomenslikmulighetfinnes,vilvi påetnyttogbedregrunnlagkunnedrøftehvilkenrolleevidensbaseringenkunnetenkes åhaienintegrertkunnskapskultur.såsantallvirkelighetpåenellerannenmåtehenger ihop,mådetjofinnesenslikmulighet.ogdetfaktumatvifaktiskeriverdenogfinner osstilretteher(sombevisstevesener),burdeborgeforatviharenvisshjemstavnsrett. Detbetyr:Ikkedualitetogfremmedhet,mentilhørighet atvihørerhjemmeiverden måregnessomdenprimæreerfaringen. Denabsoluttedualismenmellomden indre verdenogden ytre 12,dukkerdaogsåopp forholdsvissentitenkningenshistorie.viharalleredeiforrigekapittelnevntfilosofen RenéDescartes( ),somformulertedennedualismenmedstrengkonsekvens. Detharselvsagtingenmeningå leggeskylden forsplittelsenmellomdetokulturerpå Descartes skuldre. Men han var en tidlig og begavet representant for en ny livsfølelse, somgrepomsegvedinngangentildennyeretid,ogsomisinturlåtilgrunnforden videre utviklingen. Som en filosofisk teori med klare konsekvenser for vitenskap og samfunnsutvikling, står Descartes dualisme i gjeld til teorien om sansekvalitetenes 12 Hermetegnene tilkjennegir at slike talemåter selv er uttrykk for denne dualismen. Disse termene er altså ikke retorisk nøytrale. 48

49 subjektivitet. Den teorien var det ikke minst Galileo Galilei ( ) som la grunnlagetfor.dualismenliggerslikvedrotentildennyeretidsnaturvitenskap. IfølgeDescarteserverden der uteenrent utstraktting (resextensa).deninneholder kunmålbareegenskapersåsomantall,størrelse,tetthet,elastisitet,bevegelseogmasse. Vår indre verden har derimot, betegnelsen til tross, ingen slike romlige og stofflige egenskaper.deneren tenkendeting (rescogitans),hvisinnholdererfartekvaliteter, tanker og følelser. Disse er private (subjektive) og lar seg prinsipielt ikke måle. I res extensafinnesintetavrescogitans.irescogitansfinnesintetavresextensa. Detteerdenkartesianskeøksensomkløververdenito. Descartes dualisme står i markert kontrast til oldtidens og middelalderens enhetlige verdensbilde. Også Platon betegnes gjerne som dualist, men hans dualisme ligger et drøythavstykkefradenkartesianske.platonansådenmateriellevirkelighetensomen speiling (riktignok ufullkommen) av den ideelle virkeligheten; ideenes verden. Den materielle verden har altså en uttrykkskarakter; den er formet etter og uttrykker noe idémessig. Hos Aristoteles aksentueres dette ytterligere, idet ideen(formen) oppfattes somimmanent,dvs.fulltforenetmedstoffet. For oldtiden og middelalderen var naturen en organisme; levende og besjelet, beriket medallesansekvaliteterogformetetterenhensikt.detnyeverdensbildetbrøtradikalt med dette synet. Naturen ble nå ikke lenger sett på som en organisme, men som en mekanisme.ogdennemekanismenmangletikkebaresjel,menogsåfargeoglyd,varme og kulde. Disse kvalitetene hefter ikke ved tingene, mente Descartes; de er produsert i bevisstheten.altsomikkekanreduserestilkvantiteter,blirnåfordrevettilmenneskets privateindre. Hva er det da egentlig igjen der ute? Det er vanskelig å si, nettopp fordi tingene selv tenkesribbetforalleerfartekvaliteter,dvs.atvimåtenkebortalleegenskaperunntatt demålbare.riktignokkanvisiomentingatdener fargeløs,menisåfallhardenidet minsteenellerannengråtone.menhellerikkegråtonerfinnes derute,ifølgegalileis ogdescartes tankesett.visnakkeraltsåikkeomen gråogfargeløs (les:stusslig,men tross alt forestillbar) verden. Vi snakker om noe som mangler alle kvaliteter, og som dermedprinsipieltikkekanerfares.kortsagt:visnakkeromenabstraksjon,ogslettikke omnoesomfortjeneråkallesen verden. Menhvordankomsådennespøkelsesaktigeaffærentilåblioppfattetsomdenobjektive sannhetenomnaturen?utgangspunktetvar,somnevnt,forestillingenomatnaturenkun huser deprimæresansekvalitetene.mendissestørrelsene,såsomantall,lengde,vekt, volum,posisjonogfart,harvijoførst hentetutavtingene.deersomsagtdannetved 49

50 abstraksjon. Når vi så erklærer dem som tingenes egentlige egenskaper, blir det som å ribbeenhøneogsåerklærefjærhaugenforåværedenvirkeligehønen. Dissetankeneendretikkevårerfaringsverden,iførsteomgang.Mendelagrunnenforen egenartetvektingavdekvalitetervierfarer.detsomsorterteinnunderdenytreverden fikketterhvertstatussomrealitet,mensdetsomhørtetildenindreverdenstadigmer fikkkarakteravillusjon,jf.figur9. ILLUSJON Verdiladet Hensiktsfull Viljestyrt Personlig Umålbar Subjektiv Innsikt DenskolastiskeautoritetSinn PersonligViljesbestemtMaterie OrganiskHensiktsmessig Erfaring Teleologisk Objektiv Målbar Upersonlig Determinert Hensiktsløs Verdifri REALITET Figur9:Splittelsenmellomdenindreogdenytreverden,frarundt1600.EtterRadin(1997:281). Ivalgetmellom illusjon og realitet,ervitenskapenåpenbartforpliktettilåvelgedet siste. Dette leder da frem til kjernen i den positivistiske illusjonen; forestillingen om en objektivitetuberørtavsubjektet. Overlevelsesstrategier Descartes krassedualismekanvisstnoktenkes,menknaptnokleves.ingenkanlevemed helesegitoverdenersomikkehengerihop.nåhardescartes dualismedahellerikke mangetilhengereivårtid;denersnarerevårtidsproblem.ogivitenskapeligforstand, erdenetuløstproblem.fysikerennickherbert(1985:249)serdetslik: Vitenskapens største mysterium er bevissthetens natur. Det er ikke slik at vi har dårlige eller imperfekte teorier om menneskets oppmerksomhet [awareness]; vi harrettogslettingenteorieroverhodet. NårHerbertsier ingenteorieroverhodet,mådetlesesslik:viharingenteoriersomeri standtilåforklarebevissthetnedenfra,dvs.fysikalsk.virkelighetenlarsegaltsåikkeuten videre reduseres til en res extensa. Så langt er det ett poeng til Descartes. Men på den andresidenerdet,somsagt,krevendeåleveisplittelsenmellomtoverdenersomikke harnoefelles. 50

51 En vanlig overlevelsesstrategi er selvsagt å ignorere problemet. Som regel skjer dette ved at man knytter an til en naiv empirisme, som glemmer subjektets konstruktive bidrag i våre persepsjoner. I sin mest naive form identifiserer den virkeligheten med denumiddelbareiakttagelsen.( Detiakttatteervirkelig. )Denneholdningen,somogså erennaivmaterialisme,erselvsagtaldriheltgjennomført.somhjalmarheggepåpekeri sinbok,erkjennelseogvirkelighet,erdetsnakkomenprinsipiellerkjennelsesholdning somkunkaneksistereiulikegrader,slik homoeconomicus stårforenvissholdningi økonomiskeforhold.(hegge,2003:13) Naturvitenskapen har, naturlig nok, vært sterkt preget av denne holdningen, som i sin ideologiserteskikkelsefremtrersompositivismeogscientisme.mensomviskalkomme tilbaketil,skjerdetnåendreiningogsåistoredeleravnaturvitenskapen.iløpetavdet sistehundreåretharf.eks.kvantefysikkenerkjentatobservatøren(subjektet)ikkekan ignoreres i forsøkssituasjonen. Idealet om den udeltagende observatør er her erstattet med innsikten om at subjekt og objekt hører sammen, for å si det med Gadamer. En udeltagende observasjon finnes strengt tatt ikke, annet enn som en illusjon. Men som sådankandenværeenmaktfullfaktor. Enannenoverlevelsesstrategieråleggeallvektpåsubjektet.Dennestrategienomfatter alle mulige former for filosofisk idealisme, tankeretninger som på ulike vis kretser omkring motivet verden er min konstruksjon. Dette gjelder alt fra de strømninger som rettogslettikkeharplasstilproblemetomen ytrevirkelighet (sompostmodernisme og sterk konstruktivisme), til de som mer argumenterende benekter den ytre verdens eksistens(solipsisme). Slik dualismen ligger ved roten til den vitenskapelig revolusjonen, går den skisserte splittelsentversgjennomallefag,synligellerikke.ipsykologiendannermotsetningene psykoterapiogbehaviorismeettypiskeksempel.forpsykoterapienermentaletilstander realefenomener,somenkaninfluerepåogforskepå.behavioristeneså mentalistiske fenomener(såsomtanker,ideer,ønsker,lidenskaper,osv.)somillusjoner.måletvarå drive dem ut av psykologien og erstatte dem med målbare faktorer, ytre observerbar adferd,stimulusogrespons.vedåeksternaliserehelepsykologienpådennemåten,ville ensuksessivtarbeidesegnedtildensannevirkeligheten:resextensa. Ågjøreverdenheligjen Stårvalgetkunmellomdetoekstremene,objektivismeogsubjektivisme,ellerfinnesdet entredjemulighet?detmåtteisåfallinnebæreåleggedescartes dualismebaksegtil fordelforetsynsomevneråforsoneogintegreresubjektetsindreverdenmeddenytre, sansbarevirkeligheten.åoppdageatvårepersepsjonererbegrepsformet,åpnerallerede 51

52 opp for en slik mulighet. Det er her viktig å presisere mulighet. At all sansning er begrepsformetkannemlig,iførsteomgang,tolkespåtomåter: T1:Detfinnesdetingenobjektiverfaringavverden der ute,sidenallsansninger begreps elleridéformetogaltsåinfisertmed subjektivitet. T2: Ideererikkenoe rentsubjektivt.atvårepersepsjonereridéformet,viserat objektetforpersepsjonenselverformetavetobjektivtidémessigelement. T1gårutfraatideener subjektiv,sidendenalltiderfaresidettenkendesubjekt.den mulighet at det skulle kunne oppstå noe objektivt i det tenkende subjekt (T2), blir da utelukket.ment1falsifiserersegselvvedhvertankeledethandlingvigjøriverden,der en objektiv tilgang til verden både forutsettes og får sin bekreftelse. Å benekte denne objektivetilgangenmedføreratallminbevisstheterprivat,hvilketigjenmedførerden absurde konsekvens at verden og andre mennesker kun eksisterer som en del av min privatebevissthet(solipsisme). Ågjøreverdenheligjen(iførsteomgangforvårtanke)forutsettertoavgjørendesteg, sominnebærerennødvendiginnrømmelsetilhveravsidenesubjekt objekt. Det første steget er å innse at det som viser seg i og for bevisstheten som den ytre verden,visersegiogforbevisstheten.dettehøresutsomentruisme,ogerdetogså.at allerfaringskjeriogforbevisstheten,iogfordeterkjennendesubjektet,kanvanskelig benektes. Men konsekvensen av denne enkle innsikten, er ikke triviell. Den river vekk grunnlaget for teorien om sansekvalitetenes subjektivitet, og dermed også for den kartesianskedualismen.dettekanviinnseutfradetfølgende: Sidenallesansekvalitetererfaresiogforbevisstheten,mådetteogsågjeldeforsåkalte primæresansekvaliteter,dvs.dekvantifiserbareegenskapene.ogsådemå(quaerfaring) oppstå hos den som observerer i det øyeblikk tingen sanses. Er farger og toner subjektive (dvs.iogforbevisstheten),vel såmådetsammeogsågjeldeforstørrelse ogform.mendetteerikkealt:forsansningenvariererdelikesåvelsomfargerogtoner medvårsubjektiverelasjontiltingene.idetvigårgjennometromvilengjenstand,f.eks. eteplesomliggerpåetbord,variereforvårsansningbådeiformogstørrelse,ogdetfor hvert skritt vi tar. Likedan vil trærne nedover en allé som vi står ved enden avforvår sansningværeavulikstørrelse.detteviserikkeatsansningener feil (fordendømmer ikke om sitt eget innhold!), men det viser at erkjennelsen ikke er uttømt med sanseiakttagelsen.foråkommetilenobjektivsannhetomverdentrengerviogsåideen. Vimåfaktisktenke! Men det var jo nettopp slike ustabile forhold ved sanseiakttakelsene, som fyrte opp underdescartes sansesubjektivismemht.farge,lyd,varmeogkuldeosv.descartessier følgendeomdetteisin3.meditasjon(nr.19): 52

53 Nårdetgjelderforestillingeneomdelegemligeting,såerdetintetidemsomerså perfektatdetikkeskullekunneutgåframegselv.fornårjegnærmereundersøker hverenkeltavdem[ ]såfinnerjegmegetlitesomoppfattesklartogtydeligidem, kun: størrelse,ellerutstrekningilengde,breddeogdybde; form,somerenfunksjonavdenneutstrekning; posisjon,somerenrelasjonmellomulikelegemersomharform; bevegelseellerendringavposisjon. Tildettekantilføyes substans,varighetogantall. Men for de øvrige kvaliteter, så som lys og farger, lyder, lukter, smaker, varme og kuldeogandrekvalitetersomkankjennesvedberøring,forestillerjegmegdisseså uklart og forvirret, at jeg ikke engang vet om disse forestillinger er sanne eller falske,ommineforestillingeromdemerforestillingeromvirkeligetingellerikke. Descartes skarpe todeling av verden innebærer altså en videreføring av den naive empirismen,idetnoensansekvalitetervedtassom objektive ibetydningen uberørtav subjektet. Paradoksalt nok har Descartes selv allerede i sin 2. meditasjon (nr ) oppdaget at all persepsjon er begrepsformet. I sine betraktninger over et stykke voks, somhanvarmeropp,kommerhanfremtilatallesansekvaliteter,selvdekvantitative,er flyktige og kan gjennomgå uendelige forandringer. Dessuten er alle våre sansninger gjennomsattav bedømmelser : Nårvoksenerforanosssierviatviserden,ikkeatvibedømmerdetslikutfradens fargeellerform;ogdettekunnefåmegtilåtroatkunnskapomvoksenkommerfra detøyetserhellerennkunutfrasinnetspersepsjon.mendetteeråpenbartfeil,noe det følgende eksempel viser: Hvis jeg ser ut av vinduet og ser menn som krysser plassen,slikjegakkuratgjorde,sierjegatjegsermenneneselv,akkuratsomjegså voksen. Likevel, alt jeg ser er hatter og frakker, som kunne skjule roboter. Jeg bedømmerdettilåværemenn.noejegtroddejegsåmedøyneneeraltsåbegrepet eneogalenemedmittsinnsevnetilbedømmelse. Men Descartes rygger tilbake for de subjektivistiske konsekvensene som han her ser seileopp.derfortarhanvarepåenlitenrestavnaivrealisme,noktilatdetskalkunne væreigjenenverden der ute.detkarakteristiskeforallnaturvitenskapetterdescartes ernettoppdensammeinkonsekvensen,somhjalmarheggepåpeker: Hvis det nemlig er så at alle sansekvaliteter, altså også de såkalte primære: utstrekning, form, bevegelse, etter den mekanistiske sanseteori må erklæres for subjektive produkter av ytre påvirkninger, så bortfaller eo ipso muligheten for å forklare sansekvalitetene som frembrakt ved elektromagnetiske eller mekaniske bølgerogbevegelsermotsanseorganene.[det]somskalværedensåkalteobjektive ytterverdens påvirkninger på sanseorganene, og som skal gi impulsen til de hjerneprosesser som tenkes å frembringe de subjektive fornemmelser av farve, tone etc., de er nemlig selv qua bevegelse, bølge etc. å oppfatte som subjektive fornemmelser eller sansebilder. Og som sådanne kan de jo ikke påvirke sanseorganene og gjennom dem frembringe sansefornemmelser. For en slik påvirkningkanselvsagtbarekommefraenvirkeligbølgeellerbevegelse,ogikkefra ensombarebeståri indre,subjektivefornemmelser[ ] Den subjektivistiske sanselære er således konsekvent gjennomtenkt direkte selvmotsigende. Ikke desto mindre har den altså vært hevdet, og har spilt en stor 53

54 rolleifilosofiskogvitenskapeligtenkning.idissetilfellerharmansåledesåpenbart unnlatt[ ]åtrekkedenkonsekvensavlærensomlardensselvmotsigelsetrefrem. Man har med andre ord forfektet den oppfatning at farver, toner etc. bare er subjektive fenomener, men har samtidig villet opprettholde forestillingen om de molekylæreogatomæreprosessers[ ]realitetogobjektivitet.(hegge,2003:43) Åinnseatallerfaringskjeriogforsubjektet(bevisstheten),vilføretilensubjektivistisk konklusjon(f.eks.álafilosofengeorgeberkeley),medmindrevinågjørenmotsvarende innrømmelse til den andre siden. Også denne er, i første omgang, av en tilsynelatende triviellkarakter. Dennestestegeternååinnseatdetsomslikkommertilsyne(forbevisstheten)somen ytreverden,faktiskerenytreverden.tilsynelatendeerdettestegetliketrivieltsomdet første,daenbenektelsejomåttebetyatviikkehartilgangtilenverdenutenforvåregen private bevissthet. På den andre siden er en slik benektelse nettopp konsekvensen av denkartesianskedualismen,siden:iresextensaerintetavrescogitans.irescogitanser intetavresextensa. Eksemplerpåhvadetmedføreråikkegjøredenneinnrømmelsen,finnervimangeav.Og ironisknokfinnesdeikkeminstinnenforenavde hardeste avallenaturvitenskapelige disipliner; nevrobiologien.vi skal nøye oss med ett illustrerende utsagn, fra biologen RainerWolf: Våriakttagelsesverdenvirkersåfullkommen,atviureflektertidentifisererdenmed denrealeverden utenåværeossbevissthvortvilsommevåreiakttagelserer[ ] Vi befinner oss på sett og vis i et mørkerom, der vi ser et show som består av beregningsresultatene fra våre syns, hørsels, smaks og luktnerver. Vi kan ikke kommeutavdettefangenskapet,kanikkebaneossveiutavnerveneforåkomme ut i den sanne virkeligheten [.] Hele dette showet synes oss imidlertid så overveldende lyst og differensiert, at det forekommer oss uvirkelig ja, spøkelsesaktig åikkeholdedetforåværedenrealeutenverden.(wolf,1987) Inkonsekvensen i en slik posisjon (kalt nevrokonstruktivisme!), er slående: Straks vi snakkerom syns,hørsels,smaks ogluktnerver gjelderdetobservasjoneravenreal verden der ute,observasjonersominesteomgangbrukestilåbenekterealitetenavden sammeverden.enstørrekontradiksjonerdetvanskeligåbegå. Nåkunneviselvsagtspørreomvåreforestillingeromverdenvirkeliggjørnoenforskjell, sålengevåropplevelseavverdenjoikkevilendres.ellervildenlikeveldet,etterhvert? FilosofenogpsykiaterenThomasFuchsmenerdetavgjortgjørenforskjell,ogatsåvelvi selvsomverdenendrersegmedvårontologi,dvs.medvårtbildeavverdenogossselv: Ville det være så ille da, om den subjektive virkeligheten i et naturvitenskapelig perspektivoppfattessomethjernekonstrukt,sålengeviellersidetpraktiskelivog ivårhverdagfortsetterågåutfraatvåresansningereradekvate? Svaretlyder: Det vi erklærer for å være en illusjon, det betrakter vi etter hvert heller ikke som relevant og virksomt. Det får en laverestående, sekundær eksistens og dets betydningblirtappetforverdi.det egentlige utspillersegdaalltidetannetsted 54

55 ennderviførsttror,ogbarevitenskapeligeeksperterkanforklareossdet.hvisvi forklarer den virkeligheten vi opplever som et virtuelt konstrukt, berøver vi oss dermedgrunnlagetforvårautonomi.(fuchs,2008:48) Sammenlagtbetyrdetonevntestegeneentankemessigtilbakevisningogovervinnelse avdenkartesianskedualismen:vierdelaktigeiverden,ogverdenerdelaktigioss.men detteinnebærerogsåatvimågitilbaketilverden der utealledekvaliteterdenerblitt ribbetforgjennomdesiste400årene.skogenviligjenmåttebligrønn,blomsterengen dufter som før, gresshoppene synger og sitronen er sur.for de fleste av oss er dette neppesærliguvelkomneellerskremmendeperspektiver.mendetvilkrevelittrevisjoni endellærebøker,somf.eks.idenne: Nårvisierviserengrønngressplen,betyrdetatviopplevernoeihjernensomvi har lært å kalle grønt. Hva andre mennesker opplever, kan vi ikke vite. Farger er alltidknyttettilopplevelserihjernen.nårvisierat lysetergrønt,menerviikkeat selve lysstrålen er grønn, men at vi får en grønn opplevelse i hjernen når dette lysettrefferøyet.(hernes,2003:215) Læreboken parafraserer(sannsynligvis uten å vite det) Descartes og Galileis doktrine omsansekvalitetenessubjektivitet.ogsidenhjernenidagstårforrescogitans,mådet vel være der vi finner de grønne opplevelsene. At det aldri er blitt observert noen grønneopplevelserihjernen,verkenidenhviteellergråhjernemassen,fårdaværesom detvil.empirienfårskjøttesegselv,sååsi. Åisolerebevisstheten(subjektet)franaturen,varsakligsettaldrinoengodidé.Mendet positivebidraget,varatdetgavossenstørremulighettilåvåkneopptilenindividuell selvbevissthet. Først ved å skyve naturen på avstand, kunne vi erfare et avsondret jeg. (IkkeutengrunnerDescartes mestberømteslagord:jegtenker,altsåerjeg.)oppgaven fremoverkanikkeværeåarbeideviderepåenslikjeg isolasjon,somalleredelangthar overskredetsitthistoriskemål.enbedreparolevillevære:selvstendig,menikkeisolert. Når naturen skyves på avstand, blir den gjen stand, dvs. bokstavelig talt: Det som står igjen.selvpersonertingliggjøresmedøkendeavstand:førstblirøynenessjelfullhetog ansiktetsmimikkvanskeligålese.deretterforsvinnerlukteroglyderogallmulighetfor samtale. Så forsvinner også fargene. Til slutt er alt vi står igjen med noe som beveger seg eller etromlegeme eller enprikkihorisonten ;resextensa.omtrentslikvardet vi mistet naturens liv og sjel:ved å opprette en økende kognitiv avstand, ble naturen fravristetsineegnekvaliteterogverdier.dermedbledenogsåmålbarogkontrollerbar. Skalnaturenigjenkunnebliladetmedverdierogkvaliteter,mådenaltsåinnrømmesde egenskaperdescartesreserverteforrescogitans.fraåhaværtbetraktetogbehandlet som en mekanisme, uten liv og sjel, må naturen gjenoppdages som organisme. James LovelocksGaiahypotese(ideenomjordensomenlevendeorganisme),erénavsignalene omatdenneprosessenalleredeerkommetgodtigang. 55

56 Kapittel5:Evidensbaseringietvitenskapsfilosofisklys Evidenspositivismen Ideforegåendekapitlenebledetgittenpresentasjonogtolkningavpositivismestriden, som ledet oss helt tilbake til roten av den nyere tids vitenskap og den kartesianske dualismen. Hvilken relevans har så alt dette for evidensproblematikken? Det korte svareteratdetteerenviktigdelavevidensbevegelsensidéhistoriskekontekst.åforstå karakteren av denne bevegelsen, som et vitenskapsteoretisk og vitenskapshistorisk fenomen,erknaptnokmuligutenåhainnsiktidennekonteksten.ogakkurathererdet noksåevidentatingenrct studierkankommeosstilhjelp.vikommerikkeutenomå forholde oss til kontekst og mening, noe som igjen fører oss inn til kjernen i evidensproblematikkenselv. Evidensbevegelsenerofteblittidentifisertsompositivistisk,spesieltslik evidensbasert kunnskap fremstår som verdifri og kontekstfri (Ekeland, 2009). At heller ikke ideer verdsettessomennødvendigdelavevidensbasertkunnskap(atkinson,2000;jf.fig.3), gjørdenogså idéfri.signaturenforpositivismenerdanettoppdenselvforglemmende naiviteten, som består i å neglisjere ideens andel av empirien. Ved å overse subjektets konstruktiverolleidenempiriskeerkjennelsen,kanenopprettholdeforestillingenom enrenogubesmittetobjektivitet. Riktignokerdetbevegelsenskritikeresomharsattdenneidéhistoriskediagnosen.Dens tilhengere har ikke signalisert noe behov for å diagnostisere seg selv på denne måten. Nåharevidensbevegelsendahellerikkeutmerketsegmedåværespesieltorientertiog motfilosofisketankeretninger.iallhovedsakvardensgrunnleggerepragmatikere,som villeforbedremedisinskpraksis,vedåbaseredenpå bestmuligempiriskevidens og hva som virker. Det er liten grunn til å tro at de var spesielt opptatt av 1920 tallets logiskepositivisme(grimen,2009a).så,hvordankanbevegelsendaoverhodetknyttes til positivismen somenspesifikkfilosofiskretning? Som skissert stikker positivismens røtter helt ned til opprinnelsen for den nyere tids naturvitenskap.hvadenskjerneangår,erdengrunnlagtpå1600 talletavgalileogalilei ogrenédescartes.påsinveividerefremgjennomårhundrene,blirdenstadigklarere utformet som en filosofisk tankeretning. I så måte går den innom milepeler som David Hume på 1700 tallet, Auguste Comte på 1800 tallet og Moritz Schlick på 1900 tallet. Menpositivismenermerennenfilosofi.Deneretkulturfermentogetsuperparadigmei en400 åriglangvitenskapstradisjon.denerhovedstrømmen,somalledevilfølgesom ikkeaktivtsvømmerienannenretning.medunntakavnoenfåepisoder,somdentyske 56

57 romantikken,villeidenneperiodenenhvernaturforsker,somikkevarspesieltfilosofisk skolertellerinteressert,drasiretningavpositivismen.ogdeterherevidensbevegelsen kommer inn. Dens positivisme skyldes ikke smitte fra 1920 tallets logiske positivisme, menarvfranaturvitenskapensgudfedre.omenunnskyldersykdomsmetaforen,kandet ogsåsiesslik:desomidenneperiodenikkeblirfilosofiskvaksinert,fårsykdommen. Når det gjelder en drøfting av det vi kan kalle evidenspositivismen, leter vi forgjeves i evidensbevegelsens egne skrifter, tross kritikernes gjentatte utfordringer på nettopp dettepunktet.etterdenstyggemedfartensomble1920 talletslogiskeempiristertildel, har positivist ikkeværtnoemanselvharkaltseg,mennoemaneventuelterblittkalt avandre.evidensbevegelsenforetrekkerdaogsååkalleseg empirisk orientertheller enn positivistisk.spørsmåleteromdetidettetilfelletblirnoenforskjellåsnakkeom. Ellerhvaskalvioverhodetforståmed empiriskevidens? Empiriskevidens Atnoeerevidentforossbetyr,somnevnt,atvihardirekteinnsiktidet.Noefremtrer klart og tydelig; det er innlysende. I matematiske eller logiske sammenhenger er det snakkomenrentindreerfaring,skjøntdenofteunderstøttesavtegnogsymbolereller f.eks. av et geometrisk bevis. Men dette beviset, slik det foreligger på arket, er ikke evidentforossførviharutførtdenødvendigetankemessigeoperasjoner.førstnårdette er gjort, og vi altså har opparbeidet beviset for vårt indre blikk, kan vi snakke om en evidenserfaring. I prinsippet kan prosessen gjennomføres helt uten blokk og blyant. Såfremt evidensen følger av rent tankemessige operasjoner, rekker det med forestilte geometriskeformer.menogsåherforholderviosstiliakttagelser.detviiakttarietslikt tilfelle, er imidlertid ikke ytre objekter, men tankeobjekter; rene former, begreper og forestillinger. Vikanhaevidensiformavinnsiktinoeviikkeser,ioptiskforstand.Derimotharviingen evidenserfaring for det vi ser med øynene,om det ikke også følges av innsikt. Evidens kanaltsågjeldesåvelindre(bevissthetsmessige)somytre(sansemessige)fenomener, menmedenklarasymmetri:innsiktenmåialletilfellerværeder. Ordetempiriskbetyr bygdpåerfaring.åhaempiriskevidensbetyråhadirekteinnsikti et erfart fenomen eller saksforhold. Det vi erfarer kan være et sanseobjekt. Det er da alltiderfartsomspesifikkekvaliteteriethelhetligformuttrykk.menvierfarerogså indre former, som tanker og følelser. Og vi erfarer rene begrepsrelasjoner, som i et logisk ellermatematiskbevis.herstøtervialleredepådenførstepositivistiskebias,som(slik det alltid skjer) også har nedfelt seg i det språklige og dermed fått definisjonsmakt. Ifølge en innarbeidet vane, blir erfaring tolket som sanseerfaring, noe som innsnevrer definisjonenav empirisk til:basertpåsanseerfaringer.mensomvistharvibådeenytre 57

58 ogindreempiri.meddisseuttrykkene,somvivilbrukederdeternødvendig,brukervi rettogslettordet empiri isinleksikalskegrunnbetydning: bygdpåerfaring. Ensentralgrunntilat empiri harfåttenavkortetbruksbetydning,ervårtilbøyelighet tilåregneindreerfaringersom private.(jf.denrimeligautistiskeuttalelsenpåslutten avforrigekapittel:hvaandremenneskeropplever,kanviikkevite.)mendetteerigjenen delavvårpositivistiskearv,somsprekkerstraksdenfårlyspåseg.menssanseinntrykk erprivate,erdetikkenoevidelersålettogeffektivtsomtanker!omduernærsyntog jeg er langsynt, vil våre synserfaringer bli nokså ulike, og disse forskjellene er private. Menskjøntviikkekandelesanseinntrykk,kanvimeddeledemiforestillinger,bilderog begreper. Ogselvomvisanserhvertvårtindividuellekvadrat,vilkvadratrotenav16bli4foross begge. Her møtes vi i en felles indre tankeverden, som også gjenfinnes der ute i de geometriskeformene.dertilkommer,somvistideforegåendekapitlene,atallerfaring avsanseverdenenharetidémessigelement.såsantvisernoebestemt,erbestemmelsen enkognitivprestasjon.en idéløs rexextensafinnesikke,annetennsomenabstraksjon. Nåkantankenbevegesegraskereogdekkestørreområderennkroppenogsansene.Vi vet mangt om den empiriske virkeligheten, som vi ikke selv har sett og sanset. Hvis vi utdannerosstilsnekker,kandetgodtværeatvimålæreommangematerialersomvi ikkeselvhargjorterfaringermed.iandrefagerdettesnarereregelenennunntaket.det vi da forholder oss til er rapporter om andres erfaringer, samt deres slutninger ut fra dette.hvilkenevidensharslikekunnskaper?detkommeranpå.vikaniførsteomgang tropålærerensellerlærebokensfagligeautoritet.skjøntvioftemånøyeossmedenslik kvalifiserttro,erdetteselvsagtennåikkeevidentkunnskap.menføresviskrittforskritt inn i saksforholdene, kan tro avløses av innsikt som går ut over egne sanseerfaringer. Kjennerduegenskapenetilstålogbetong,kanduforståbeskrivelsenavstålbetongens egenskaper.kunnskapomempiriskeforholdsomformidlesteoretisk,kanværeevidenti dengradviopplysesomkausalforhold(årsak>virkning)ellerføresinnienmeningsfull sammenheng,somgirossenkontekstforståelse. Åforholdesegtilrapporteromandreserfaringer,fremfordenegnedirekteerfaringen, utgjør riktignok et ekstra ledd på veien til empirisk innsikt. Men tidsmessig er denne omveienoftedenraskesteveien.dessutenerdetdenveienvimåslåinnpå,omvivilha enkunnskapomverdensomgårutoveregnesanseerfaringer.mulighetentilåhøsteav andres erfaringer er, tross alt, grunnlaget for hele vår kunnskapskultur. Men denne hvilerogsåpåatvievneråskillemellomhvaviselvharerfart,oghvaviinnserutfradet andre har fortalt oss. Det første kan vi kalle en primær empirisk evidens, det andre en sekundær.mulighetenforfeiltakelserfinnesselvsagtibeggetilfeller. 58

59 Atvinormaltskatterprimærempiriskevidenshøyereenndensekundære,berorikkeså myepåsikkerhetenierkjennelsensompåatdet,utoverlogiskeogmatematiskeforhold, kunerdeenklesteempiriskeerfaringersomkanformidlesfullstendig,verbaltellerved symboler.enenkelmåling(denneplankener2.13cm)blirikkesærligmerrikholdigom jeggjørdenselvennomdenblirmegfortalt.eventueltkanminegenmålingværemer nøyaktig, men i prinsippet er all relevant informasjon om lengde formidlet. Riktignok kan det selv her være noen skjulte variabler (er sagekanten rett?), men også de kan manideenkletilfellenetakontrollpå. Erfaringsgrunnlaget for en kompleks kvalitetsbedømmelse (dette er en dårlig planke), kanderimotsjeldenformidlesfullstendig.fordeterfarnesnekkerblikketkandetvære mangeegenskapersomliggerbakenslikbedømmelse,egenskapersomaltsåfangesopp med ett blikk og som for snekkerens øyne gir evidens for konklusjonen. Om vi spør snekkeren hvordan han ser det, kan det godt hende vi får et enkelt svar: Den er løs i veden.vedselvsyn(medetoppøvdsnekkerblikk!)kandetimidlertidvisesegatplanken ogsåharflereandretegnpådårligvirke denermisfarget,vindskeiv,harkvisthull,osv. Dervioppnårprimærempiriskevidens,oppdagervigjernemervedfenomenetenndet vi fikk formidlet idet vi forholdt oss til en annen persons empiriske erfaringer. Med økendeavstandtildetempiriskefenomenet,vilinformasjonuunngåeliggåtapt. Men kompleksiteten er ikke det eneste problemet. Skjønt kvaliteter kan representeres med tall, kan de ikke erstattes av tall. Selv om rapporter eller kvantifiseringer for praktiskehensynkangiossdeopplysningervitrengeromenfarge,kandeikkeerstatte fargeopplevelsen.denerunikihverttilfelle,ogsieralltidnoemerennrapporteneller tallet.hvanåmeddenevidensbasertekunnskapen?herservifordetførsteatavstanden tildetempiriskefenomenetøkermedettekstraledd: A.Primær empiriskevidens B.Sekundær empiriskevidens C.Evidensbasert empiri(ebk) Profesjonsutøver Profesjonsutøver Profesjonsutøver 59 Empirisk fenomen Empirisk forskning EBK (Nasjonalt kunnskapssenter) Empirisk fenomen Empirisk forskning Empirisk fenomen Tabell4:Avstandogtransparensmellomprofesjonsutøverogempiriskfenomeniulikesituasjoner. I situasjon A står legen eller læreren i direkte kontakt med det empiriske fenomenet, som førstehånds observatør. Situasjonen er i så måte den samme som for forskeren i situasjon B. De fenomener vi ikke har primær empirisk evidens for, må vi få formidlet vedandreserfaringer,somf.eks.vedempiriskforskning.menogsådettekangiossutsyn til det empiriske fenomenet. Skjønt det her, i situasjon B, er to vegger mellom oss og

60 fenomenet,såerdepotensielttransparente.(markertvedprikketlinje.)vedågåveien via empirisk forskning kan vi, skritt for skritt, erobre innsikt i en større del av verden enndendelviselvhariakttatt.vardetikkeslik,villemangennaturfagslærerkommei forlegenhet når en kom inn på eksotiske dyr som tuatara og galagos, eller avanserte fysiskefenomenersomkvarkeroggluoner. EBKproduseressomtidligerevistvedåfiltrereempiriskforskning.Detteinnebærerøkt avstandtildetempiriskefenomenet,medetekstraleddmellomprofesjonsutøverenog forskningen. Til dette kommer at EBK retter seg mot det som virker. Det vil si at kunnskapsentreneikkebefattersegmedåforklarekausaleforholdellerkontekst,slikvi (til en viss enn grad) kan forvente å finne i forskningsartikler. Her er nok å minne om hvanasjonaltkunnskapssenterforhelsetjenestenlatilgrunnisinstrategiplanfor2005: Kunnskapssenteretsrollevilsærligværeknyttettildetåevaluereogmåleogikkedetå forståmergrunnleggendemekanismerellerfortolkeopplevelserogsammenhenger. Dettefølgeriogforsegdirekteavevidensbaseringensdefinisjon.Detsomfiltreresvekk iensystematiskkunnskapsoversikt,erikkeminstforskningensbegrunnelser,spørsmål, nyanseringer,drøftinger,forbehold,idémessigekontekstosv.detgjelderher,kortsagt,alt detsomgjørossistandtilåfortolkesammenhenger.flereharpektpådetteproblemet, somf.eks.tor JohanEkeland(2004:33): At nokon lagar system som gir praktikaren lettare tilgang på kunnskap er allment eingodting.ogidenoverflodsomforskingslitteraturenidagrepresenterererdet gode argument for slike system. Men seleksjon er samstundes også filter og det som blir filtrert vekk er ofte det som kjenneteiknar vitskapeleg kunnskapsformidling: nyansane, vurdering av feilkjelder, dei kritiske vurderingane, og refleksjonihøvetilnyerkjenning. AtforholdetmellomEBKogempiriskforskningikkeertransparent,idetenvesentligdel avforskningen(kausalitetogkontekst)ikkeblirformidlet,eritabell4markertmeden lukket vegg. Men også mellom profesjonsutøveren og EBK erdet en lukket vegg. Dette speileratfiltreringsprosessenikkeerevidentforossmedmindrevigjentarprosessen.at vi kjenner de prinsipielle retningslinjene for evidensbaseringen, gjør ikke filtreringen transparentidetkonkretetilfellet.bakdenkonklusjonenkunnskapsoversiktenmunner uti,liggerdetmangeveivalg.enkeltevalgskjerutfrasåkalteobjektivekriterier,f.eks.ut fraevidenshierarkiet.(atkriterieneer objektive betyrikkeatdetikkeerutøvdskjønn, kunatdetikkeskalgjøresihvertenkelttilfelle.)andrevalgmånødvendigvisgjøresved individuelt skjønn der og da, som inkludering/ ekskludering av studier ut fra tematisk relevans. Her vil innsikt i forskningens kontekst bety mye.om alle disse veivalgene fremstårsomevidenteforkunnskapsmegleren(hvilketkanbetviles),erdeuansettikke det for brukeren av kunnskapsoversiktene. I sum ser vi at evidensbaseringen stenger utsynettildetempiriskefenomenetmedtougjennomsiktigevegger. 60

61 Deteridennesammenhengettankekorsattransparensnettopperblittetnøkkelordfor den moderne profesjonsutøvelsen(jf. neste kapittel). Den transparens det da er snakk om, gjelder altså ikke profesjonsutøverens innsyn i den empiriske feltet. Den gjelder snarereklientensogdetoffentligesinnsyniprofesjonsutøvelsen. Hvasåmedlærebøker?VilikkeogsådepåsammemåtesomEBKrepresentereetekstra ledd, som øker avstanden til det empiriske fenomenet? Ikke nødvendigvis. Dårlige lærebøker vil riktignok kunne fungere slik. Men gode lærebøker kjennetegnes for det første ved at de nettopp legger vekt på å formidle kausalitet og kontekst; veggene blir transparente. Dernest kan de (re)presentere et mer rikholdig empirisk materiale, ved bilder og tekst, enn det noen artikkel eller kunnskapsoversikt har mulighet til. Endelig kan de i hvilket som helst omfang knytte an til eventuelt ta med ekstrakter fra empirisk forskning. Dersom forfatteren selv står forskende til sitt materiale, vil dette ytterligere minske avstanden til fenomenene. Når erfarne lærere og forskere skriver lærebøker, vil vi nettopp oppleve dette. Lærebøkene, som plasseres på bunnen av evidenspyramiden, har altså mange muligheter til å formidle empirisk evidens. Det sammekanikkesiesomdesystematiskekunnskapsoversiktene. Dennyeeminensen Desomskapteevidensbevegelsen,begrunnetdenblantannetmedatmedisinskpraksis baserte seg alt for mye på faglige autoriteter og ekspertuttalelser. Autoritetstroen knyttettildenprofessoraleeminensenmåtteavløsesavenobjektivfagligevidens.eller som vittige tunger har formulert det: Den eminensbaserte kunnskapen må erstattes av denevidensbaserte. Et slikt siktemål er det intet å utsette på, gitt at det er evident hva vi skal forstå med evidensogvivethvordandenskaloppnås.mendissebetingelseneeråpenbartlangtfra oppfylt.somvisterdetsomkallesevidensbasertkunnskapugjennomsiktigirelasjontil filtreringsprosessen,såvelsomtilprimærforskningenogdeempiriskefenomenerden gransker. I praksis vil EBK dermedligne mye på den eminensbaserte kunnskapen den skulleavløse:dervimanglerinnsiktellerevidens,måvinøyeossmedtroogautoritet. Mendeterlikevelenforskjell.Dengamleeminensenvartrossaltenfeilbarligperson, som dessuten var dødelig. Ja, han var heller ikke alene om å hevde sin autoritet. Det fantes ulike oppfatninger om mange faglige spørsmål også blant eminensene, noe som utfordret den unge legen til å tenke selv og undersøke selv. Enhver fagkritikk og fagutvikling avhenger av dette, at ulike meninger får brytes i en åpen debatt. Den nye eminensenfremstårderimotsomettilnærmetufeilbarligsystemforkvalitetssikringav kunnskap.ogtakketværeeninternasjonalorganisering(cochranecollaboration),taler systemet også med én stemme. Ved å fremtre som overmenneskelig, ufeilbarlig og 61

62 udødelig, får systemet en autoritet som ingen gråhåret professor noensinne kunne drømmeom. Til dette kommer at den gamle eminensen var rede til og ofte måtte forsvare sitt standpunkt. Da måtte han overbevise skeptikerne ved å appellere til fakta og logiske sammenhenger som underbygde hans syn. Han måtte med andre ord, så vidt mulig, gi demevidensforsinepåstander.kunnskapssentre,somikkeserdetsomsinoppgave å forstå mer grunnleggende mekanismer eller fortolke opplevelser og sammenhenger, unndrar seg denne forpliktelsen. Den gamle eminensen hadde rett nok sine svakheter. Menvedåfremtresomufeilbarligogutenviljetilåutøveellerresponderepåfagkritikk, erdennyeeminensenenstørreutfordring. Selvsagterdetfortsattmuligågranskedeprimæreforskningsartiklene.Menidengrad kunnskapsoversiktene fungerer som en avlastning for dette arbeidet, hvilket vel var meningenmeddem,ervioverlatttilåtropåautoriteten.detbetyrikkeatsystematiske kunnskapsoversiktererverdiløse.devilkunneværeverdifullehenvisningertilempirisk evidens,merpresist:tilmuligekilderforempiriskevidens.mensidenslikeoversikteri regelenverkengirossinnsiktikausalitetellerkontekst,kandehellerikkegibrukeren innsiktidenempiridesammenfatter. At kunnskapsoversiktene i seg selv ikke kan gi oss evident empirisk kunnskap, er ikke problemet.somantydetkandelikevelhalivetsrett.problemeteratdisseoversiktene forveksles med slik kunnskap, og effektivt vil kunne erstatte den. Dette er vel å merke ikkeen muligfare vedevidensbaseringen,menenåpenbarsystemegenskap.ifølgesin selvforståelseerdetjonettopp evidensproduksjon kunnskapsentreneskaldrivemed. Ogsystematicreviewsutgjørdaogsåtoppsteinenialleevidenshierarkier. Settfrabrukerensperspektiv,erensystematiskkunnskapsoversiktiførsteomgangen kvalifisertpåstandom hvasomvirker.brukerenharnåtoalternativevalg: 1. Entenåantadennepåstandensom evidensbasertkunnskap,ihvilketfallhun forvekslerinnsiktmedautoritet. 2. Elleråforholdesegbevissttilkunnskapsoversiktensomenkvalifisertpåstand omempiriskevidens. Kunidetsistetilfelletstårmulighetenåpenforatbrukeren(ietgitttilfelle),serbehovet foråsjekkedenkildetilempiriskevidenssomdisseoversiktenehenvisertil.ombrukeren derimottrorhunalleredehardenneevidensenihånden,erdetjoingengrunntilågå bakenfor kunnskapsoversiktene. Med det generelle tidspresset i moderne profesjoner, og stilt overfor systemets autoritet som offentlig anerkjent evidensprodusent, blir alternativ1gjernedetmestnærliggende. 62

63 Det er ofte blitt påstått at evidensproduksjonen vil medføre en maktforskyvning fra ekspertenetilfolket.detteskaldaskjevedendemokratiseringavkunnskap,idetdetsom tidligerevar eksperteneseiendom nåblirlagtåpentutogaltså gitttilfolket.grimen (2009a) går inn på denne argumentasjonen, og avviser den ut fra noen av de samme betraktninger som her er gitt: Folket kan nok klikke seg inn på databaser for å se på kunnskapsoversiktene.menfolketharneppesåstortgrunnlagforåvurderekvaliteten pådisseoppsummeringene.detharhellerikkedenjevnelegeellersykepleier. Atpersonliginnsiktikkeeretkravellerkriteriumforenevidensbasertpraksis,medfører entendenstilåerstatteinnsiktmedregleroggodargumentasjonmedhenvisningtilrett prosedyre.detteinnebærerenutvendiggjøringavsannhetskriteriet,sommangeharsett som et illevarslende tegn for forskningen. Slik artikuleres uroen i Social Epistemology, somvietno4/2008tiltematikkenebm: Deterikkelengertillattforenforskeråsi: Herergrunnentilminpåstand,verken iretten,imedisinsklitteraturelleriklinikken.engodgrunnforåmenenoe,erikke lenger god nok. I stedet må hun si: Her er en forutfattet regel, som samstemmer medmeg.oppkomstenavebmhargjortdetillegitimtåendogforsøkeåoverprøve epistemisk autoritet. Et EBM evidenshierarki har rollen som en pavelig bulle. En protestantisk appell til en epistemisk samvittighet, vil etter all sannsynlighet ikke barefeile;denblirikkeengangansettsomlegitim.(grossman&leach,2008:328) Flere kritikere har pekt på det paradokset, at evidensbevegelsen er blitt markedsført som et opprør mot autoritetstro, mens den de facto etablerer en ny type udiskuterbar autoritet,somnettoppikkeermentåkunneoverprøvesidetenkeltetilfelle: EBM bevegelsenhartilsinegentilfredsstillelse(ikketilmin)rettferdiggjortideen omatdensspesifikkereglervilhjelpeossåbrukedenaktueltbesteevidensen.men når den har gjort det, ber den oss om å ikke bekymre oss om saken noe mer, og spesieltikkevurderedensreglerfrasaktilsak.dengirossenkatolskdoktrineomå stolepåkirkensregler,utendenkorreksjonsomhørertildenkatolskedoktrinen:at vifrasaktilsakogsåkanbrukevårsamvittighettilåoverveiereglene.(grossman, 2008:334) Utvendiggjøringenavsannhetliggeraltsåidette,atenholderenpåstandforsanneller evidentetterdemetoderdenerbasertpå,ikkeetterenvurderingavdensinnhold.ikke hvaforsøksresultatenesier,menhvordandeerprodusert,skalavgjørehvasomgjelder forsant.ogdissemetodeneskalvelåmerkeikkevurderesoppimotdetenkeltetilfellet; deeralleredekategorisertetterenfastlagtprosedyre. Tohensynhartaltforågjøreutvalgskriterienemestmulig objektive (automatiserte) ogbasertpåmetodesnarereenninnhold.fordetførsteatvitenskapogsannheterfor viktig til å overlates til personal bias, dvs. individuelle vurderinger. Dernest at det å innskrenkerommetforindividuellevurderingereffektivisererevidensproduksjonenog alleavgjørelserknyttetopptilden.detgjelderaltfraklinikken(terapi)tilforskingsrådet (forskningsstøtte)tilparlamentet(lover,bevilgningerogrammebetingelser).uttrykket 63

64 level1evidence erinternasjonaltvelinnarbeidet,såvelidenmedisinskelitteraturen somidenpolitiskeretorikken.forskningsomikkeer level1,kangreitsettestilside utenatenbehøveråvurdereinnholdetirapporten. Evidentnytale IGeorgeOrwellsroman1984introduseresbegrepetnytale(newspeak).Istatensnytale er løgnen satt i system, slik at det rent språklig er blitt nesten umulig å tale sant. Ord skiftersubtiltmening,noesomgjørdetvanskeligårealitetsorientereseg.ofteomfatter nyordetbådedengamlemeningenogdenstikkmotsatte,slikat fred f.eks.nåogsåkan bety krig. Med vår tids fredsbevarende og fredsopprettende operasjoner, har 1984s profetierforsåvidtvistsegnoksåtreffsikre. Evidensbevegelsenerikkealeneomåutvikleennytale,meninnenforsittegetfeltkan densiesåværeifront.laossmersystematisktaforossnoenavdeeksemplene,somvi alleredeharstreifetinnom.uttrykket muligbetydninginytale henspillerpåatnytalen ikkeeksplisittimøtegårbetydningenigammeltalen.detbetyratdenvedbehovogsåkan påberopeseggammeltalensbetydning,f.eks.nårennytalebetydningkritiseres. Ordog uttrykk Betydningigammeltale Muligbetydninginytale Kunnskapssenter Best evidens Etstedderkunnskapdyrkesav mangeogslik sentreres (som vedetuniversitet) elleretsenterforspesielle kildertilkunnskap(somvedet bibliotek). Best(kildetil)innsikt Empirisk Erfaringsbasert RCT basertforskning Empirisk evidens Kunnskap Erfaringsbasertinnsikt (noepersonerkanha) Viten,kyndighet,innsikt Opptrerimangeformer: artikulert taus;praktisk teoretisk;faktisk kontekstuell osv.skjøntkunnskapkan uttrykkesialtfratingtilsystemer, opptrerdensomlevende virksomhetkunhospersoner. Etstedderkunnskapfiltreres(selekteresvekk). Theresultsofthisprocessaredramaticandcheering.The 6000originalarticlesoninternalmedicinepublished eachyearingeneraljournalsaredistilledto300,and eacharticleisononepageratherthanfourorfive.thus, evenadoctorwithatbroadlybasedclinicalpracticecan keepupwiththelatestimportantadvancesinclinical researchbyreadingapageaday.sacketetal.(1995) Meta analyseavrct basertforskningpå hvasom virker identifyingthebestevidencemeansusing epidemiologicalandbiostatisticalwaysofthinking. Sacketetal.(1995) Systematiskekunnskapsoversikter/henvisningertil RCT basertforskning(noedokumenterinneholder) Etproduktsomkankvalitetssikres,lagresogomsettes etterspesifiserteprosedyrer. Systematiskkunnskapsproduksjon(forskning)er råmaterialetsomforedlesvedevidensbaseringtilen distribusjonsklarvare,somkunnskapsmeglerentilbyr. Knowledgebrokersfacilitatethetransferofknowledge fromwhereitisabundanttowhereitisneeded (Wikipedia) Tabell5:Ordforklaringerforsentraletermerievidensdebatten,ifølgegammeltaleognytale. 64

65 Nytalekarakteren består dels i at en bruker plussord som evidens og kunnskap, for alt hva de er verdt, samtidig som deres mening blir drastisk innskrenket. Tor Johan Ekeland(2009)kallerdet,somnevnt,en stilleokkupasjon avdissenøkkelbegrepene: Mankommunisererførstengenerellregel(brukedenbestekunnskap),forderetter [ ] å forholde seg til ekstremt spesifikke regler for den beste kunnskap. Slik okkupereskunnskapsbegrepetidetstille,utenvarsling. HaraldGrimen(2009b)leggerhellerikkefingreneimellom,nårhansvarerpåetinnlegg fra Terje Ogden (2008), der motviljen mot evidensbasering tolkes som motvilje mot evidens og å ta i bruk pedagogisk forskning om metoder som øker elevenes læringsutbytte. Grimen karakteriserer det som en type semantisk imperialisme å likestilleevidensmedevidensbaseringpådennemåten. Å vera skeptisk til evidensbasering [ ] medfører ikkje naudsynleg å vera mot evidens.detereintypesemantiskimperialismeåoreigneomgrepetforetbestemt føremål.[ ] Ein kan òg både meine at det er bra med forsking på verknadene av undervisningsmetodar og samstundes vera skeptisk til innføring av evidensbaseringiutdanningsvesenet,identydingasomevidensrørslaskjønerdet. Dennesemantiskeimperialismenkommerf.eks.tilsynenårdensomerskeptisktilen kunnskapsbasert praksis i evidensbevegelsens mening, blir nødt til å presisere at en verkenerimotkunnskapelleratkunnskapanvendesipraksis. Viseravsisteeksempelitabell5,atdetherogsåkommerinnetsterktretoriskinnslag frahandelogindustri.detteskalvisenærmerepåinestekapittel.herskalviførstlegge merke til at nyordene opptrer i to former, dels som nye termer(kunnskapsmegler) og delsvedatkjentetermergisennybetydning(kunnskap).bådedetførsteogdetsisteer selvsagt i og for seg helt legitimt og karakteristisk for all språkutvikling, ikke minst innenforvitenskapen.hvafysikereettereinsteinmenermedordetgravitasjon,erikke helt det samme som Newton la inn i det. Og termen kvantesprang hørte ikke med til Newtonsvokabular. Detsomkarakteriserernytalenerimidlertidatordheltkantømmesforsinopprinnelige mening,ogendogvendesomtilsinmotsetning.istedetforålageennyterm,angripes altsåinnarbeidedeordogbegreperinnenfra.dettetruermulighetentilåkunneuttrykke segklartogsannferdig.evidenspleideåbetyfullklarhetellerinnsikt.nåbrukesdetom en prosess som minsker utsiktene til innsikt, idet den stenger av for utsynet til den empiriske forskningen og de fenomener denne betrakter.kunnskap, som i gammeltale var noe kun personer kunne inneha, blir omtalt og behandlet som en ekstern ting. Filosofen Jan Inge Sørbø har treffende karakterisert nytalekarakteren ved ordet kvalitetssikring: Kvalitetereitordsomheiltharskiftameiningetteratamerikanskenæringslivsfolk fannoppfenomenet kvalitetssikring.medanordetendåvarisiuskuldstid,tydde 65

66 detatnokovargodt,etterkriteriumknyttetilfenomenetsjølv:eplevargodevedat dei smaka godt, undervisning var god ved at den var fagleg velfundert og vel framført, handverk var godt når det var grundig utført og gav eit vakkert resultat osv.etterkvalitetssikringavartoppfunnen,tyderkvalitetateinellerfleirepersonar har kontrollert fenomenet etter eit administrativt system, og kryssa av i dei rette rubrikkane.somregelhardessepersonaneeiadministrativutdanning,ogerikkje spesialistarpåeple,handverkellerfag.(sørbø,2002:316) Et annet sentralt eksempel, er den kreative omskrivningen av ordet informasjon som skjer midt på 1900 tallet. Dette ordet og begrepet skulle jo få en nøkkelrolle i den fremvoksendenyeinformasjonstidsalderen.etymologiskharordet informasjon sinrot idetlatinskeinformatio,sombetyrbegrepelleridé.verbetinformarebetyrslikåforme enidé.åspørreomdetfinnesinformasjoninaturen,ermedandreordsynonymtmedå spørre om naturen huser ideer. Denne spirituelle betydningen er selvsagt milevidt fra detdatafolkidagmenermed informasjon.såhvaskjedde? Det som skulle bli kalt den matematiske informasjonsteorien, ble utviklet i 1948 av Claude Shannon. På denne tiden hadde radiotelegrafi og morsekoding allerede lenge vært i bruk. Neste steg var televisjon og datakommunikasjon. Den oppgaven Shannon hadde definert for seg var å effektivisere signaloverføringen av meldinger. Til dette trengtesenmodellforhvasomskjervedkommunikasjon.shannonsmodellvarslik: Figur10:ClaudeShannonsmodellforinformasjonsoverføring. Vikjennerigjendenlineæremodellen,medenveiskjøring. Detsomherkalles informationsource og destination kunneværeenmaskinelleren person.shannonhaddekunblikkfordentekniskesidenvedinformasjonsoverføringen. At det alltid står et subjekt bak informasjonskilden så vel som målet var irrelevant for hans modell. Likedan var meldingens semantiske innhold, dens mening, irrelevant. Shannonsieromdette: Det fundamentale problemet i kommunikasjon er hvordan en kan reprodusere på ettsted eksaktellertilnærmet enmeldingsomervalgtutpåetannetsted.som regelharmeldingeneenmening;dvs.atdepåenellerannenmåterefererertileller er korrelert med visse fysiske eller begrepsmessige størrelser. Disse semantiske aspektene av kommunikasjon er irrelevante for ingeniørproblemet [overføringen avmeldingen]. 66

67 IdetShannonvelgeråsebortframeningsaspektetvedkommunikasjon(hvilketiogfor seg er legitimt!) skulle en tro han visste han ikke befattet seg med informasjon som sådan,menmeddetekniskeaspektervedkommunikasjon.tittelenpåhans1948 essay (AMathematicalTheoryofCommunication)skulletydepådetsamme. Her skjer det noe merkelig. Shannon erklærer på den ene siden at han ikke vil befatte seg med informasjon i egentlig mening, dvs. det semantiske aspektet. Men så går han likefullt derfra og definerer noe han kaller informasjon. Han drøfter ikke minst hvordanenkanmålemengdenavinformasjonienmelding,oghanenderoppmeden matematiskformelfordette: H= P ilogp i Formelengiretmatematiskuttrykkforsummenavsannsynlighetenforhverttegn(eller signal) som opptrer i meldingen. At en slik kvantifisering kan være nyttig for visse tekniske operasjoner innenfor datakommunikasjon, er lett å innse. Men å identifisere dette med informasjon, er en ganske annen sak. Da Shannon i 1949, sammen med matematikeren Warren Weaver, presenterte sin teori i bokform, ble den kalt The Mathematical Theory of Communication. Boktittelen til tross; Shannon ble kjent som informasjonsteoriensfar.oghanfortsattedaogsååinsisterepåatdetvarinformasjon hanhaddeutvikletetmatematiskmengdemålfor,baremeddenpresiseringathanmed informasjon ikkementedetvivanligvismenermedordet.warrenweaver(1949)sa detslik: Ordetinformasjoneridenneteorienbruktienheltspesiellbetydning,somikkemå forveksles med den vanlige bruken av ordet. Spesielt må informasjon ikke bli forveksletmedmening.faktiskerdetslikatomvihartomeldinger,derdeneneer tungt lastet med mening mens den andre er rent nonsens, kan de ifølge dette perspektivetværeheltekvivalentnårdetgjelderinformasjon. [...]ordetinformasjonikommunikasjonsteorienrelaterersegikkesåmyetildetdu faktisk sier, som til det du kunne ha sagt. Det vil si at informasjon er et mål på valgfrihetennårenvelger[symbolenetil] enmelding. Pådennemåtenkomordetinformasjontilåskiftemeningfraåbetynoebegrepsligeller idémessig,tilåendeoppsombetegnelseforrekkefølgenavelektroniskesignaler, bits &bytes.noesomkanvære(ellerrepresentere) rentnonsens. Etsliktdypdykkinytalenskarakterogutviklingkandelsorientereossomhvorsubtilt dethelegårforseg.menviserogsåatdetsystematiskgåriengittretning.detsomfør varknyttettilen subjektontologi (subjektetsverden)blirkonsekventlagtinnunderen objektontologi,idetdetblirkvantifisert,eksternalisertogtingliggjort.vikansedette som en dypstruktur i moderniteten.denne nytalen er, som evidensbevegelsen, en av fruktenepådettvedeltekartesiansketreet(jf.figur9).pådenøverstegrenen,somhører til subjektets verden, får alt etter hvert karakter av illusjon. Skal det berges over i 67

68 realitetenesverden,mådetpodesinnpådengrenensombærer objektivefrukter.men siden intet av res cogitans finnes i res extensa, er det såre lite du får berget på denne måten.detenestehåndfastedufårtameddeger,somdetheter, dekonkretetallene. Menintetersålitehåndfastogkonkretsomtall. Subjektogobjekteruløseligsammenbundet.Deterførstforsubjektetatverdenderute er verden og derute.menpåsinsideblirsubjektetførstsubjektvedatdetstillerseg overforetobjekt.dersubjektogobjektrivesfrahverandre,tømmesbeggeforinnhold. Gregory Chaitin og Werner Siefer beskriver presist hva denne prosessen munner ut i: Verdenblirkvalitetsløsebits&bytes,ogmenneske jegetblirenillusjon. Datamaskinen har fremprovosert et paradigmeskifte, som foreslår en digital filosofi, en ny måte å se verden på, der alt er diskret [oppdelt] og intet er kontinuerlig, der alt er digital informasjon, 0 ere og 1 ere. Dataforsker Gregory Chaitin, Den store erkjennelsen i bevissthetsforskningen er: Jeget er en ren innbilning. Hjernen oppfinner seg selv. Vitenskapen berøver oss dermed vår kjerne. Det finnes riktignok en jegopplevelse, en jeg-følelse, men den er ikke etterprøvbar. Selv om man tok hjernen fra hverandre, la oss si som en blomkål, ville man ikke oppdage noe som man kunne peke på og si: Her har vi nå jeget. Biologen Werner Siefer,

69 Del3:EBPiskoleogsamfunn 69

70 Kapittel6:Evidensbaseringogsamfunn Scientificmanagement Idetforegåendeerdetpektpåenidémessigforbindelsemellomevidensbevegelsenog positivismen.kjernenidetteeratkunnskap(merellermindreeksplisitt)identifiseres med objektivering, kvantifisering og(subjekt )eksternalisering. Det siste fremtrer som nytale ved at ord, som betegner det et subjekt kan inneha i en subjekt objekt relasjon (kunnskap,evidens),implisittellereksplisittfåren objektiv eller ekstern betydning. Detbliromtaltogbehandletsomentingutenformennesket,noesomkanlagres,sendes hitogditogomsettessomenvare.tildettebildethørerdetogsåmedatinstrumentelle prosedyrer,somtjenertilåformalisereogstandardisere produksjon og omsetning av kunnskap,griperomsegiforskningsåvelsomiprofesjonspraksis. Allusjonenetilproduksjonsspråket,somvikjennerfraindustrioghandel,ertydelige.Vi hørersnakkom kunnskapsmeglere som letteroverføringenavkunnskapfraderdet eroverskuddtilderdeterknapphet (Wikipedia),ogvistøterpåomtaleravpedagogikk somteknikkerfor hvordanenlevererinstruksjon (USDE). Tankenomåeksportereerfaringerfraindustriellmasseproduksjontilulikeprofesjoner ogsamfunnsområder,erikkeheltfersk.isinanalyseavdeseneretiårsstyringslogikker, minner Ekeland (2004:57) oss på at slike program var uttenkt alt ved 1900 tallets begynnelse: Ingeniøren Fredric Taylor skapte seg eit namn i denne perioden gjennom programmetscientificmanagement,eitprogramsomgavopphavtiltidsstudiarog rasjonalisering basert på empiriske data. Tilsvarande program vart lansert for sjukehus av Ernest Codman i I ettertid kom slike system i miskreditt av ein enkelgrunn:deiverkaikkjefordifolkreagertenegativtogoppførtesegannleisenn kalkylanetilsa.vikantrulegseiedetsåenkelt:deifannsegikkjeiåbliobjektiverte. Taylorismen mislykkes i første omgang mht. den konkrete tillempningen av systemet. Debærendeideenebleimidlertidikkeforlatt;dedukketbareoppigjenimeroppdaterte versjoner.oghvavarså debærendeideer itaylorssystem? DetvarisitthovedverkThePrinciplesofScientificManagement(1911)atF.W.Taylorla fremsittprogramforen vitenskapeligarbeids ogbedriftsledelse.systemethaddetil hensiktåøkeeffektivitetenialleledd,noesomvilleøkeavkastningenforbedriftene elleridetminstefordesomlåforaniutviklingen.ogdette,regnettaylormed,villeogså komme arbeiderne til gode i form av høyere lønninger, kortere arbeidstid og generelt bedrearbeidsforhold. 70

71 Hvordanskullesådisseiogforsegutmerkedemåleneblioppnådd?Etgrunnleggende middelvar tids ogbevegelsesstudier,somgavmulighetforåidentifisere,analysereog standardisere hver arbeidsoperasjon. Idealet var hentet fra de, allerede den gang, standardiserte arbeidsprosessene i industrien. Spesielt hadde Henry Ford vist vei med sin samlebåndsproduksjon av T Forden (1908). Her var hvert ledd i produksjonen standardisert,ogdenenkeltearbeiderhaddekunansvarforåfølgeprosedyrenforsitt punkt i prosessen. I sitt verk Teknopolis, fremhever Neil Postman(1992:57) at en slik standardiseringnettoppkrevdeat den enkelte arbeiders dømmekraft [ble] erstattet av lover, regler og prinsipper somfremgikkavarbeidets vitenskap.detinnebarselvsagtatarbeidernemåttegi avkall på sine tradisjonelle måter å forholde seg på, med erfaring og øyemål; arbeiderne ble fratatt ethvert ansvar for å tenke. Systemet skulle tenke for dem. Dette er vesentlig, for det førte til en forestilling som hører til Teknopolis grunnleggendeprinsipper:atteknikkkanerstattetenkning. En kan også kalle dette en eksternalisering av tenkning og vurdering, noe som viser slektskapetmellomtaylorsscientificmanagementogpositivismen. PostmanskillerforøvrigmellomteknokratierogTeknopolis.Forskjellenkarakteriserer hanpåfølgendemåte: Teknokratiereropptattavåoppfinnemaskiner.Atdissemaskineneogsåforandrer menneskersliv,blirsettpåsomenselvfølge,ogatfolkiblantmåbehandlessomom devarmaskiner,betraktessomenuheldigognødvendigfølgeavdenteknologiske utviklingen. Men i et teknokrati ansees dette ikke for grunnleggende prinsipp for kulturen. Teknokratiet har ikke satt seg som mål å gjennomføre en omfattende reduksjonisme,hvormenneskelivetmåfinnesinmeningimaskineriogteknikk.et sliktmålerdetbareteknopolissomstreberetter.ifredericktaylorsverkfinner man, så vidt jeg kan se, for første gang klart formulert at samfunnet er best tjent medatmenneskerstillestildisposisjonforsinteknikkogteknologi,ogatdepåsett ogvisermindreverdtennmaskinenesine.hanogtilhengernehansgavenpresis beskrivelseavhvadetinnebærer,oglovprisersinegenoppfinnelsesomopptakten tilenvidunderlignyverden.(ibid) SomnevntmøtteTaylorssystemaktivmotstandfradesomskulleinnordnesegdet.Og hansnavnvillevelogsågåttiglemmeboken,vardetikkeforatnyemanagement ideer, somdelermangeavtaylorismenssentraletrekkogidealer,stadighardukketoppigjeni løpetav1900 tallet.evidensbevegelsenerendelavdettebildet. NewPublicManagement Detergått100årsidenTaylorlansertesittprogramforeffektiviseringavarbeidslivet, ettermodellfrabilindustrien.etoppslagiklassekampenden20.april2011minneross påatidealenefortsattleveribestevelgående.overskriftener: UniversitetetiOslobrukermetoderfrabilindustrien:Frykterfabrikken 71

72 Reportasjengårinnpåeneffektiviseringsmetodikk,LEAN,utarbeidetavbilfabrikanten Toyota.Frauniversitetetsledelseheterdetisaksfremleggetat: LEAN vil brukes som standardisert prosesskartleggingsverktøy der det er hensiktsmessig. Dette er et verktøy som brukes til å koble tid og ressurser på en standardisertmåte. Åanalysereelementeneiarbeidsprosesseneogskaffesegenoversiktovertidsbrukeni hvertledd,erførstestegienprosesssomharsommålåeffektivisereogstandardisere detadministrativearbeidet.representantenfordentl organiserteiadministrasjonen, erikkespesieltbegeistretfordenneideen: Man står med stoppeklokka for å ta tida på hva man skal bruke på hver eneste oppgave.deterdetaljertkartleggingpåminutterforhverarbeidsoppgave.menalle somjobberhervetatmanbrukerarbeidstidpåtingsomikkeerforutsigbare den vanskelige studentenellerprofessorensomtrengerhjelp.mendetmålesikke,og blirdermedikke produktivvirksomhet. Rektoratet avviser imidlertid at hensikten er å foreta en slik stoppeklokkevurdering. Sakenerfortsatt(våren2011)tilbehandling,ogutfalleterennåikkegitt.Menvikjenner igjen mønsteret: Mens ledelsen vil effektivisere gjennom standardisering og prosedyreregler,stritterdeansatteimotetsystemsomredusererdereshandlingsrom. Universitetets ledelse har, ironisk nok, gitt dette effektiviseringsprosjektet tittelen Internthandlingsromsprosjekt(IHR).Muligensendaeteksempelpånytale. LEAN systemeterdelavenstørreeffektiviseringsbølge,derogsåevidensbaseringhører med.denstørrebølgen,somgrepomsegfrabegynnelsenav1980 tallet,kallesgjerne New Public Management(NPM). Dette var(og er) et kompleks av ideer og drivkrefter, med et sterkt samfunnsomformende potensiale. Foss Hansen & Rieper (2009) nevner firesentralekjennetegnvedbevegelsen,som dannedeenklangbundforoprettelsenav deorganisationer,derarbejdermedsystematiskeforskningsoversikter : Mål ogresultatstyring(managementforresults/valueformoney) Evalueringsbølgen(performancemeasurement,somf.eks.LEAN) Dokumentasjonogkvalitetssikring(accountability/transparency) Profesjonaliseringavvelferdsstatensservice(herunderevidensproduksjon) Tildettehørerogsåetfemtepunkt,somgårpåintegrasjonenmellomdetoffentligeog markedet: Privatiseringsbølgen og konkurranseutsetting av tidligere offentlige tjenester sompost,skole,sykehjemosv. Detsosialbyråkratiskesamfunn På den ene siden skjer det en byråkratisering og juristifisering av næringslivet, blant annetirelasjontilerstatningsansvarogkravtildokumentasjon.pådenandresidenøker 72

73 markedslogikken og markedsmakten innenfor det offentlige. Dermed blir grensene mellom næringslivet(markedet) og det offentlige(demokratiske organer og rettslivet) uskarpe.densektorensomskrumperinnunderdenneutviklingen,erdensivilesektor. Alleinitiativer,organisasjonerogkulturforetakutenomstatogmarkedtenderermotå bli marginalisert, om de da ikke finner sin plass et sted langs denne aksen, som statsstøttetellermarkedstilpassetvirksomhet. Dennesamfunnsutviklingensamsvarergodtmeddeprospekterdaværendeprofessori markedsføring,leifholbæk Hanssen,presentertei1976,dvs.rettførNPM utviklingen skjøtfart.(bokenhetmetoderogmodellerimarkedsføringen,bindiii.)holbæk Hanssen skildrer her tre mulige samfunnstilstander, med ulik autonomi og styrke for de tre samfunnsområder, som han kaller:kultur eller inspirasjonssystemet(den sivile sektor), rettssystemet(offentligsektor)ogøkonomisystemet. Ideelt(1)herskerdetenlikevektmellomdissetreområdene.Deharhverforsegenviss autonomi, slik at det går an å skille mellom dem. I et bilde (2), som Holbæk Hanssen kaller dagensbalanse,harrettslivet/detoffentligeogøkonomisystemet blåstsegopp påbekostningavdetfrittståendekulturlivetoginvadertdette. Fremskriver vi denne tendensen, får vi et fremtidsbilde (3) som kanskje er nå der rettssystemogøkonomisystemomtrentersmeltetsammen.rettssystemethartattoppi seg idealene om fri konkurranse. Institusjoner innenfor alle nivåer og sektorer har et målomåbefesteseg,helstvokse,imarkedet.etsentraltmiddelerdakvalitetssikringog økt effektivitet i alle ledd. Samtidig preges økonomisystemet stadig mer av rettslige reguleringer og et tilhørende byråkratisk kontrollregime. Det autonome kulturlivet forblirialtdetteetubetydeligvedheng.dettefremtids ellernåtidsbildetkallerholbæk Hanssendetsosial byråkratiskesamfunnet.offisieltdyrkerdetidealeneomdemokratiså velsomfrimarkedskonkurranse.mendetmanglendeskilletmellomdeto,skaderbegge samfunnsområder: Markedet ris av byråkratisering, samtidig som markedslogikken behersker demokratiet. Uten korreksen fra et sterkt og autonomt kulturliv, vil det som beherskerdembeggeværeteknopolis idealer.ifølgepostman(1992:56)gjelderdisse idealene,slikdeerutformetitaylorstheprinciplesofscientificmanagement: overbevisningenomatdetfremste,omikkedetenestemålformenneskeligstrev og tanke, er effektivitet. Likeledes at tekniske kalkyler er den menneskelige dømmekraftoverlegenienhverhenseende,ogatmanprinsipieltikkekanstolepå den menneskelige dømmekraft overhodet, fordi den er belemret med slurv, flertydighetogunødigkompleksitet;atsubjektiviteterethinderforklartenkning; atdetsomikkekanmåles,entenikkeeksisterer,ellererutenverdi;ogatfolksveog velbestskjøttesaveksperter. 73

74 enhver som skal meta analysere funnene kan ha store problemer med å finne ut hvormangeforsøkdetharvært. Atkliniskeforsøkikkeblirrapportert,kanhersynesåværedetmindreproblemet.Men for en statistisk behandling, som ved en meta analyse, kan dette alene være nok til å forvrenge bildet av effekter og bieffekter. At forsøk som fører til et ugunstig resultat (settfrasponsorsside)ikkeblirpublisert,erivitenskapsteorienkjentsomfile drawer effekten. Der retten til publisering er forbeholdt sponsor, er dette et problem å regne med. Og det kan også skje at forsøk som på et tidlig tidspunkt må antas å føre til et ugunstig resultat, avbrytes før de er gjort ferdige. Hvor stort dette problemet er i medisinskforskning,finnesdetingeneksaktetallpå.meniendanskstudie,gøtzscheet. al. (2007), var de fleste forsøk som det fantes protokoller på (172 av 274), aldri blitt fullførtellerpublisert. Åinvitereenforskersombidragsytertilenartikkel,erengodsøknadomfåinvitasjon tilbake.ombidragetkunbeståravnoenfåsetninger,spillermindrerolle.ogskulledu være så heldig å få en prominent forsker med på laget, øker det din egen status, mulighetene for publisering og fremtidig forskningsstøtte.om vedkommende ikke har bidrattmednoeannetennenvelvilligtittpåmanus,betyridensammenhengingenting. Ienkeltemiljøererdetogsåenselvfølgeatdendistingverteprofessoren,somselvikke har tid til å drive forskning, skal ha sitt navn fremst i artiklene som produseres av stipendiater og andre av instituttets fotfolk. En eufemistisk tittel på slike bidragsytere, er honoraryauthors (hedredeforfattere). Å få artikler gjennom i de mest velrenommerte journalene, er uansett ikke helt enkelt for en ensom forsker. Det kan ta mer enn ett år fra artikkelen er levert inn til denblir publisert, ofte etter flere runder med omarbeidinger. Her har det dukket opp et eget marked,kalt ghostmanagement.deterherikke(idetminsteikkeprdefinisjon)snakk omnoenulovligvirksomhet,menomprofesjonellhjelptilålosedeggjennomprosessen fraprosjektplanleggingtilpublisering. 14 Er du etstørrefarmasøytiskforetak,hardu også råd til å betale for den hjelpen. Og det finnes også journaler som tilpasser seg markedslogikken,vedatfagfellevurderingogpubliseringgårunnapånoenfåuker.til gjengjeld må du betale dyrt for overhodet å få vurdert et manus, og enn mer for selve publiseringen. Detteerikkeperifererandfenomener.Ifarmasøytisk sammenhengerdetsomregelet industrieltforetaksomerartikkelens spøkelse,somaltsåreeltstårbakundersøkelsen ogdensinnhold.detvilsi:ogsåiforskningensandreende,nårdetgjelderåutføreselve 14 Innenfor medisinen går slike firmaer gjerne under betegnelsen medical education and communication companies (MECC). Eksempler på dette er: Complete Healthcare Communications (CHC) og Current Medical Directions (CMD). I USA finnes flere hundre slike selskaper. 75

Studieplan for Kunnskapsbasert praksis

Studieplan for Kunnskapsbasert praksis Studieplan for Kunnskapsbasert praksis 15 studiepoeng Høyskolen i Sør Trøndelag Avdeling for sykepleie 2008 1 Godkjent dekan ved avdeling for sykepleie 22.01.08 2 Innhold 1.0 Innledning... 4 2.0 Mål...


Kunnskapsbasert praksis (KPD) innen læring og mestring hva menes? Dagssamling for LMS i Midt-Norge 29.april

Kunnskapsbasert praksis (KPD) innen læring og mestring hva menes? Dagssamling for LMS i Midt-Norge 29.april Kunnskapsbasert praksis (KPD) innen læring og mestring hva menes? Dagssamling for LMS i Midt-Norge 29.april Forskergjengen ved NK LMH Dagmara Bossy Una Stenberg Kari Eika Helge Skirbekk André Vågan mestring.no


Hva vi tror og hva vi vet; når er det nok kunnskap for implementering til praksis?

Hva vi tror og hva vi vet; når er det nok kunnskap for implementering til praksis? Hva vi tror og hva vi vet; når er det nok kunnskap for implementering til praksis? Grete Dyb Dr.med., Spesialist i barne og ungdomspsykiatri Nasjonalt kunnskapssenter om vold og traumatisk stress (NKVTS)


Finne litteratur. Karin Torvik. Rådgiver Senter for Omsorgsforskning, Midt Norge Høgskolen i Nord Trøndelag

Finne litteratur. Karin Torvik. Rådgiver Senter for Omsorgsforskning, Midt Norge Høgskolen i Nord Trøndelag Finne litteratur Karin Torvik Rådgiver Senter for Omsorgsforskning, Midt Norge Høgskolen i Nord Trøndelag Ulike former for kunnskap Teoretisk og praktisk kunnskap Teoretisk kunnskap er abstrakt, generell,


Kunnskapsbasert praksis

Kunnskapsbasert praksis Kunnskapsbasert praksis Katrine Aasekjær Senter for kunnskapsbasert praksis 12.06.13 Evidence Based Practice Evidence Based Medicine Evidence Based Nursing Evidence Based Dentistry Evidence Based Mental


Hva er kunnskapsbasert praksis?

Hva er kunnskapsbasert praksis? Hva er kunnskapsbasert praksis? Professor Monica W. Nortvedt Senter for kunnskapsbasert praksis Avdeling for helse- og sosialfag Høgskolen i Bergen 21.06.2011 www.kunnskapsbasert.no Hva skal jeg snakke


Hvorfor jobbe. kunnskapsbasert?

Hvorfor jobbe. kunnskapsbasert? Regional ReHabiliteringskonferanse Sunnaas sykehus HF og Helse Sør-Øst RHF 22. Oktober 2013 Kunnskapsesenterets Hvorfor jobbe nye PPT-mal kunnskapsbasert? Gro Jamtvedt, avdelingsdirektør, professor i fysioterapi


Kunnskapsbasert praksis - eksempler på hvordan vi kan holde oss faglig oppdatert

Kunnskapsbasert praksis - eksempler på hvordan vi kan holde oss faglig oppdatert Kunnskapsbasert praksis - eksempler på hvordan vi kan holde oss faglig oppdatert Nina Rydland Olsen Stipendiat Senter for kunnskapsbasert praksis Høgskolen i Bergen Nina Rydland Olsen Kunnskapsbasert praksis


Kunnskapsbasert arbeidsmetode. og fagprosedyrer

Kunnskapsbasert arbeidsmetode. og fagprosedyrer Kunnskapsbasert arbeidsmetode Kunnskapsesenterets nye PPT-mal og fagprosedyrer Hvordan lage gode fagprosedyrer Kurs 14.januar 2010 Gro Jamtvedt, avdelingsdirektør Kunnskapsesenterets nye PPT-mal God kunnskap


Kunnskapsbasert praksis

Kunnskapsbasert praksis Kunnskapsbasert praksis Professor Monica W. Nortvedt Senter for kunnskapsbasert praksis Avdeling for helse- og sosialfag Høgskolen i Bergen Lederkonferanse 17. til 19. mars 2010 www.kunnskapsbasert.no


Kunnskapskilder og litteratursøk i klinisk praksis. Fjernundervisning 21.04.15 Kristin Østlie Seksjonsoverlege ph.d. Sykehuset Innlandet HF

Kunnskapskilder og litteratursøk i klinisk praksis. Fjernundervisning 21.04.15 Kristin Østlie Seksjonsoverlege ph.d. Sykehuset Innlandet HF Kunnskapskilder og litteratursøk i klinisk praksis Fjernundervisning 21.04.15 Kristin Østlie Seksjonsoverlege ph.d. Sykehuset Innlandet HF Kunnskapsbasert praksis Ulike typer kunnskap Forskningsbasert


Profesjonsdanning og samfunnets evidenskrav

Profesjonsdanning og samfunnets evidenskrav Profesjonsdanning og samfunnets evidenskrav UHR konferanse Levanger 19. - 20. Mars 2013 Bodil Tveit Førsteamanuensis, Diakonhjemmet Høgskole, Oslo Institutt for sykepleie og Helse 1 «Godt samspill og samarbeid


Implementering av kunnskapsbasert praksis som ledd i kvalitetsforbedring

Implementering av kunnskapsbasert praksis som ledd i kvalitetsforbedring Implementering av kunnskapsbasert praksis som ledd i kvalitetsforbedring Monica W. Nortvedt Senter for kunnskapsbasert praksis, Høgskolen i Bergen Kunnskapssenterets årskonferanse 5. juni 2009 Hva skal


Blodtrykksmåling - METODERAPPORT

Blodtrykksmåling - METODERAPPORT Blodtrykksmåling - METODERAPPORT Formålet med prosedyren: Formålet med prosedyren er klart definert og avgrenset: Å øke kunnskapen hos helsepersonell, slik at blodtrykksmåling utføres på en sikker og hensiktsmessig


Kunnskapsesenterets Utvikling av nasjonale retningslinjer nye PPT-mal for slagbehandling

Kunnskapsesenterets Utvikling av nasjonale retningslinjer nye PPT-mal for slagbehandling Helsedirektoratet, 01.09.2008 Kunnskapsesenterets Utvikling av nasjonale retningslinjer nye PPT-mal for slagbehandling Atle Fretheim, Forskningsleder, Seksjon for forebygging og internasjonal helse Hva


Studieplan. Studieår Våren Videreutdanning. Kunnskapsbasert praksis. 15 studiepoeng

Studieplan. Studieår Våren Videreutdanning. Kunnskapsbasert praksis. 15 studiepoeng Studieplan Studieår 2014-2015 Våren 2015 Videreutdanning 15 studiepoeng HBV Fakultet for helsevitenskap Høgskolen i Buskerud og Vestfold, Campus Drammen Postboks 7053, 3007 Drammen tlf. 31 00 80 60 Studieprogrammets



Obstipasjon METODERAPPORT Obstipasjon METODERAPPORT Formålet med prosedyren: Formålet med prosedyren er klart definert og avgrenset: Å øke kunnskapen hos helsearbeideren slik at obstipasjon hos pasienten forebygges eller behandles


Kurs i kunnskapshåndtering å finne, vurdere, bruke og formidle forskningsbasert kunnskap i praksis. Hege Kornør og Ida-Kristin Ørjasæter Elvsaas

Kurs i kunnskapshåndtering å finne, vurdere, bruke og formidle forskningsbasert kunnskap i praksis. Hege Kornør og Ida-Kristin Ørjasæter Elvsaas Kurs i kunnskapshåndtering å finne, vurdere, bruke og formidle forskningsbasert kunnskap i praksis 16.mars 2007 Hege Kornør og Ida-Kristin Ørjasæter Elvsaas Nasjonalt kunnskapssenter for helsetjenesten


Hvilken nytte har vi av

Hvilken nytte har vi av Astrid Austvoll-Dahlgren Forsker, Nasjonalt kunnskapssenter for helsetjenesten Hvilken nytte har vi av brukerkunnskap? Innhold Hva? Hvorfor? Hvilken? Hva menes med brukermedvirkning? De som berøres av


Administrering av øyedråper og øyesalve METODERAPPORT

Administrering av øyedråper og øyesalve METODERAPPORT Administrering av øyedråper og øyesalve METODERAPPORT Dette er en felles metoderapport for administrering av øyedråper og administrering av øyesalve. Formålet med prosedyren: Formålet med prosedyren er


Evidensbasert sykepleie i møte med praksis

Evidensbasert sykepleie i møte med praksis Evidensbasert sykepleie i møte med praksis En kvalitativ studie basert på intervju med 8 intensivsykepleiere Avvenning av respirator som eksempel på evidensbasert sykepleie. Hvordan erfarer intensivsykepleiere


Videreutdanning i kunnskapsbasert praksis i

Videreutdanning i kunnskapsbasert praksis i Videreutdanning i kunnskapsbasert praksis i helsetjenesten (KUNNO) Further Education in Evidence-based Health Care 15 studiepoeng - deltid Godkjenning Godkjent av rektor ved Høgskolen i Akershus 3. juni


Kunnskapsbasert praksis innen læring og mestring

Kunnskapsbasert praksis innen læring og mestring Kunnskapsbasert praksis innen læring og mestring 30. oktober 2014, Gardermoen André Vågan seniorforsker, NK LMH Hva er kunnskapsbasert praksis? - Å utøve kunnskapsbasert praksis er å ta faglige avgjørelser


Formuler et. fokusert spørsmål. sammenstill resultatet. - Hvilken type forskning besvarer best spørsmålet? - Hvor finner jeg slik forskning?

Formuler et. fokusert spørsmål. sammenstill resultatet. - Hvilken type forskning besvarer best spørsmålet? - Hvor finner jeg slik forskning? et rsmål Tenk over: - Hvilken type forskning besvarer best spørsmålet? - Hvor finner jeg slik forskning? er det om? / hva skjer? ater Vurdér søkeresultatet og endre evt. søkestrategien sammenstill resultatet


Hvor og hvordan finner du svar på

Hvor og hvordan finner du svar på Grunnkurs A allmennmedisin 27. november, 2015 Hvor og hvordan finner du svar på kliniske spørsmål? Helsebiblioteket.no Irene W. Langengen, forskningsbibliotekar, Helsebiblioteket.no Nasjonalt kunnskapssenter


Forskning og kvalitetsutvikling - 2 sider av samme sak? Gro Sævil Helljesen, prosessleder, RN, MSc Helse Sør-Øst RHF 26 august 2010

Forskning og kvalitetsutvikling - 2 sider av samme sak? Gro Sævil Helljesen, prosessleder, RN, MSc Helse Sør-Øst RHF 26 august 2010 Forskning og kvalitetsutvikling - 2 sider av samme sak? Gro Sævil Helljesen, prosessleder, RN, MSc Helse Sør-Øst RHF 26 august 2010 WHO (1993) fem hovedområder for å vurdere og evaluere kliniske virksomheter:


Hvordan Kunnskapsesenterets

Hvordan Kunnskapsesenterets Foredrag på seminaret Rehabilitering av brystkreftpasienter, 11. mars 2009 Hvordan Kunnskapsesenterets jobber vi med en systematisk nye PPT-mal oversikt Lene K. Juvet, (prosjektleder) Forsker, PhD. Hvorfor


Intravenøse infusjoner i PVK og SVK - METODERAPPORT

Intravenøse infusjoner i PVK og SVK - METODERAPPORT Intravenøse infusjoner i PVK og SVK - METODERAPPORT Metoderapporten er felles for prosedyrene om intravenøse infusjoner i perifert venekateter (PVK) og sentralt venekateter (SVK). Formålet med prosedyren:


Hvilke krav bør stilles til skolebaserte tiltak? Thomas Nordahl, NOVA 15.04.04

Hvilke krav bør stilles til skolebaserte tiltak? Thomas Nordahl, NOVA 15.04.04 Hvilke krav bør stilles til skolebaserte tiltak? Thomas Nordahl, NOVA 15.04.04 Skolens oppgave og hensikt Opplæringen skal utvikle elevenes evner og muligheter, åndelig og kroppslig, og gi dem gode allmennkunnskaper


Høringssvar - NOU 2011:6 Et åpnere forskningssystem

Høringssvar - NOU 2011:6 Et åpnere forskningssystem Legeforeningens sekretariat Deres ref.: Vår ref.: 08/67 Dato: 28.09.2011 Høringssvar - NOU 2011:6 Et åpnere forskningssystem Viser til anmodning fra sekretariatet om høring vedrørende Fagerbergsutvalgets


Regionsenter for barn og unges psykiske helse (RBUP Nord)

Regionsenter for barn og unges psykiske helse (RBUP Nord) Forebyggingsenheten Regionsenter for barn og unges psykiske helse (RBUP Nord) Disposisjon Oppdrag og målsetning. Vitenskapelige kriterier. Prosedyrer. Presentasjon av databasen på nettet. Spørsmål og drøfting.


Prosjekt 2011 2014. Kunnskapsbasert praksis for pasientsikkerhet og kvalitet. Seksjon for kunnskapsbygging i Nordlandssykehuset

Prosjekt 2011 2014. Kunnskapsbasert praksis for pasientsikkerhet og kvalitet. Seksjon for kunnskapsbygging i Nordlandssykehuset Prosjekt 2011 2014 Kunnskapsbasert praksis for pasientsikkerhet og kvalitet Prosjektleder Nora Frydendal Hoem Seksjon for kunnskapsbygging i Nordlandssykehuset Nasjonal satsing på kvalitet Styresak 42/10


Samvalg. Farmasidagene 2015. Simone Kienlin. Prosjektkoordinator Delprosjekt regionalt nettverk Kunnskapsstøtte Helse Sør-Øst

Samvalg. Farmasidagene 2015. Simone Kienlin. Prosjektkoordinator Delprosjekt regionalt nettverk Kunnskapsstøtte Helse Sør-Øst Samvalg Farmasidagene 2015 Simone Kienlin Prosjektkoordinator Delprosjekt regionalt nettverk Kunnskapsstøtte Helse Sør-Øst Mitt valg Indikasjon samvalg alternativ Medisinsk problem krever valg innebærer


Spørsmålsformulering. - hva skal du lete etter hvor? Hanne Elise Rustlie prosjektbibliotekar i litteratursøk Sykehuset Innlandet HF

Spørsmålsformulering. - hva skal du lete etter hvor? Hanne Elise Rustlie prosjektbibliotekar i litteratursøk Sykehuset Innlandet HF Spørsmålsformulering - hva skal du lete etter hvor? Hanne Elise Rustlie prosjektbibliotekar i litteratursøk Sykehuset Innlandet HF Agenda v Kunnskapsbasert praksis v Forberedelse til litteratursøk v Spørsmålsformulering


Evidensbasert brukermedvirkning. Andreas Høstmælingen Spesialist i klinisk psykologi Fagsjef, Norsk Psykologforening

Evidensbasert brukermedvirkning. Andreas Høstmælingen Spesialist i klinisk psykologi Fagsjef, Norsk Psykologforening Evidensbasert brukermedvirkning Andreas Høstmælingen Spesialist i klinisk psykologi Fagsjef, Norsk Psykologforening Profesjoner Organisatorisk aspekt Kontroll over arbeidsoppgaver (monopol, autonomi) Jurisdiksjon


Systematiske Kunnskapsoppsummeringer (Systematic reviews)

Systematiske Kunnskapsoppsummeringer (Systematic reviews) Kunnskapsesenterets nye PPT-mal Systematiske Kunnskapsoppsummeringer (Systematic reviews) Samarbeid for forskning 23. mars 2009 Gro Jamtvedt, avdelingsdirektør Plan for presentasjonen Hva er en systematisk


Kompresjonsbehandling - METODERAPPORT

Kompresjonsbehandling - METODERAPPORT Kompresjonsbehandling - METODERAPPORT Dette er en felles metoderapport for prosedyrene Generelt om kompresjonsbandasjer og Legging av kompresjonsbandasjer. Formålet med prosedyren: Formålet med prosedyren


Kunnskapssenteret er ti år. Er helsetjenesten blitt mer kunnskapsbasert?

Kunnskapssenteret er ti år. Er helsetjenesten blitt mer kunnskapsbasert? Kunnskapssenteret er ti år. Er helsetjenesten blitt mer kunnskapsbasert? Magne Nylenna En av Kunnskapssenterets kjerneaktiviteter er å samle, vurdere og formidle forskningsbasert kunnskap om effekt av


Forskningsbasert utdanning i BLU

Forskningsbasert utdanning i BLU Forskningsbasert utdanning i BLU Seminar om implementering av barnehagelærerutdanning SAS hotellet Oslo 17. januar 2013 Prorektor Ivar Selmer Olsen Dronning Mauds Minne Høgskole for barnehagelærerutdanning


Avføringsprøve METODERAPPORT

Avføringsprøve METODERAPPORT Avføringsprøve METODERAPPORT Formålet med prosedyren: Formålet med prosedyren er klart definert og avgrenset: Å øke den kliniske kunnskapen hos utøveren slik at avføringsprøve innhentes på en forsvarlig


9. JUNI 2011 Hege Selnes Haugdahl Forskningssykepleier FoU-avdelingen

9. JUNI 2011 Hege Selnes Haugdahl Forskningssykepleier FoU-avdelingen OPPLÆRING I KUNNSKAPSHÅNDTERING -NYTTER DET? 9. JUNI 2011 Hege Selnes Haugdahl Forskningssykepleier FoU-avdelingen Oppsummering Opplæring i kunnskapshåndtering nytter, men endrer nødvendigvis ikke praksis



SJEKKLISTE FOR VURDERING AV EN FAGLIG RETNINGSLINJE SJEKKLISTE FOR VURDERING AV EN FAGLIG RETNINGSLINJE FØLGENDE FORHOLD MÅ VURDERES: Kan vi stole på retningslinjene? Hva forteller retningslinjene? Kan retningslinjene være til hjelp i praksis? Under de


Veiledere - Retningslinjer - Prosedyrer Friends or Foes?

Veiledere - Retningslinjer - Prosedyrer Friends or Foes? Veiledere - Retningslinjer - Prosedyrer Friends or Foes? Begrepsavklaringer og to eksempler fra klinisk praksis Kristian Lexow, overlege Anestesiavdelingen Stavanger universitetssjukehus Norsk Resuscitasjonsråd


Urinprøve og urinstiks METODERAPPORT

Urinprøve og urinstiks METODERAPPORT Urinprøve og urinstiks METODERAPPORT Formålet med prosedyren: Formålet med prosedyren er klart definert og avgrenset: Å øke kunnskapen hos helsearbeideren slik at urinstiks og urinprøver tas på en forsvarlig,


Informasjonssøking i sykepleiers praksis

Informasjonssøking i sykepleiers praksis Informasjonssøking i sykepleiers praksis eller MIND THE GAP! Margrethe B. Søvik UH-Bibliotekkonferansen 18.-19. juni 2015 En presentasjon av prosjektet Et forprosjekt med midler fra Nasjonalbiblioteket


Nasjonale strategier,-

Nasjonale strategier,- Kunnskapsesenterets nye PPT-mal Nasjonale strategier,- bidrag til kunnskapsbasert praksis Nasjonal nettverkskonferanse HiB, april 2009 Gro Jamtvedt, Avdelingsdirektør og førsteamanuensis Kunnskapsbasert


Oppgaven: Evidens for omlegginger i sykehus

Oppgaven: Evidens for omlegginger i sykehus Kunnskapsesenterets nye PPT-mal Oppgaven: Evidens for omlegginger i sykehus Anne Karin Lindahl, avdelingsdirektør i Nasjonalt kunnskapssenter for helsetjenesten Evidens Vitenskapelig dokumenterte effekter


Hva er evidence based medicine? - et felt med klare utfordringer?

Hva er evidence based medicine? - et felt med klare utfordringer? NSHs Årskonferanse 2005 9. september 2005 Hva er evidence based medicine? - et felt med klare utfordringer? John-Arne Røttingen, direktør Nasjonalt kunnskapssenter for helsetjenesten Disposisjon Evidence


hva virker, hvorfor og hvordan?

hva virker, hvorfor og hvordan? Workshop og kurs: Kunnskapsbasert politikkutforming Kunnskapssenteret, 24. mars 2010 Kunnskapsesenterets Mulige tiltak nye PPT-mal hva virker, hvorfor og hvordan? Målsettinger for denne sesjonen Drøfte


Brukerhåndbok clinicalevidence.bmj.com

Brukerhåndbok clinicalevidence.bmj.com Brukerhåndbok clinicalevidence.bmj.com Innhold Innledning................................... 3 Finne evidensbasert informasjon.............. 4 Ved hjelp av kapittel....................... 4 Ved hjelp av


Av Live Landmark / terapeut 3. august 2015

Av Live Landmark / terapeut 3. august 2015 LITEN PLASS TIL MOTSTEMMER: Normen i ME-samfunnet er å presentere negative erfaringer. Forskerne, som fulgte 14 ME-fora over tre år, fant ingen eksempler på positive erfaringer med helsetjenesten. Den


Forord. Hvorfor lese denne boka

Forord. Hvorfor lese denne boka Forord Hvorfor lese denne boka Alt helsepersonell ønsker å praktisere på grunnlag av god kunnskap. Vi vet at kunnskap redder liv og at mangel på kunnskap kan koste liv og helse. Med en overveldende mengde


Praksisstudier i sykepleie med fokus på helsefremming og brukermedvirkning: Psykisk helsevern og kommunehelsetjeneste

Praksisstudier i sykepleie med fokus på helsefremming og brukermedvirkning: Psykisk helsevern og kommunehelsetjeneste Praksisstudier i sykepleie med fokus på helsefremming og brukermedvirkning: Psykisk helsevern og kommunehelsetjeneste Emnekode: BSNP06_1, Vekting: 20 studiepoeng Tilbys av: Det samfunnsvitenskapelige fakultet,


STUDIEÅRET 2014/2015. Utsatt individuell skriftlig eksamen. VTM 200- Vitenskapsteori og metode. Tirsdag 25. august 2015 kl. 10.00-12.00.

STUDIEÅRET 2014/2015. Utsatt individuell skriftlig eksamen. VTM 200- Vitenskapsteori og metode. Tirsdag 25. august 2015 kl. 10.00-12.00. STUDIEÅRET 2014/2015 Utsatt individuell skriftlig eksamen i VTM 200- Vitenskapsteori og metode Tirsdag 25. august 2015 kl. 10.00-12.00 Hjelpemidler: ingen Eksamensoppgaven består av 5 sider inkludert forsiden


Blodsukkermåling og diabetes METODERAPPORT

Blodsukkermåling og diabetes METODERAPPORT Blodsukkermåling og diabetes METODERAPPORT Dette er en felles metoderapport for prosedyren om Blodsukkermåling, og dokumentene Generelt om blodsukkermåling, Hypoglykemi og hyperglykemi og Generelt om diabetes.


Hvor finner du svaret? En introduksjon til informasjonskilder og databasesøking

Hvor finner du svaret? En introduksjon til informasjonskilder og databasesøking Hvor finner du svaret? En introduksjon til informasjonskilder og databasesøking Ida-Kristin Ørjasæter Elvsaas, forsker Nasjonalt kunnskapssenter for helsetjenesten ❹ Vurdér søkeresultatet og endre evt.


Desinfisering av hud - METODERAPPORT

Desinfisering av hud - METODERAPPORT Desinfisering av hud - METODERAPPORT Formålet med prosedyren: Formålet med prosedyren er klart avgrenset og definert: Å øke kunnskapen hos helsepersonell slik at huddesinfeksjon utføres på en forsvarlig,


Brukerkunnskap i behandlingslinjen

Brukerkunnskap i behandlingslinjen Brukerkunnskap i behandlingslinjen Rehabiliteringskonferansen 2011 26. oktober 2010 Are Hovland Nielsen Marit Evertsen Om prosjektet Bakgrunn for prosjektet Prosjektet tok utgangspunkt i modellen for «kunnskapsbasert


Prosjekt 2011 2014. Kunnskapsbasert praksis for pasientsikkerhet og kvalitet. Seksjon for kunnskapsbygging i Nordlandssykehuset

Prosjekt 2011 2014. Kunnskapsbasert praksis for pasientsikkerhet og kvalitet. Seksjon for kunnskapsbygging i Nordlandssykehuset Prosjekt 2011 2014 Kunnskapsbasert praksis for pasientsikkerhet og kvalitet Seksjonsleder Astrid Jacobsen Rådgiver Nora Frydendal Hoem Seksjon for kunnskapsbygging i Nordlandssykehuset Nesten ikke til


Anteriora entandsluckan - olika protetiska lösningar. En evidens-basert tilnærming

Anteriora entandsluckan - olika protetiska lösningar. En evidens-basert tilnærming Anteriora entandsluckan olika protetiska lösningar En evidensbasert tilnærming Ola Hansson Percy Milleding Sven Scholander Asbjørn Jokstad Evidence Based Medicine Evidencebased medicine is the conscientious,


Placebo effekten en nyttig tilleggseffekt i klinisk praksis?.

Placebo effekten en nyttig tilleggseffekt i klinisk praksis?. Placebo effekten en nyttig tilleggseffekt i klinisk praksis?. Martin Bystad Psykolog v/ alderspsykiatrisk, UNN og stipendiat, Institutt for Psykologi, UiT. Hensikten med foredraget: Gi en kort presentasjon


Rehabiliteringstjenesteforskning i et medisinsk perspektiv. Cecilie Røe

Rehabiliteringstjenesteforskning i et medisinsk perspektiv. Cecilie Røe Rehabiliteringstjenesteforskning i et medisinsk perspektiv Cecilie Røe Tradisjonelt omfatter medisin diagnosesetting og behandling ICF b1 b130 b134 b152 b180 b1801 s299 s710 s720 s730 s73001 s73011 d170


Evidensbaserad tandvård

Evidensbaserad tandvård Evidensbaserad tandvård Asbjørn Jokstad Institutt for klinisk odontologi Universitetet i Oslo Web-adresse: Asbjørn Jokstad, dr.odont, Universitetet i Oslo, Norge Anne Deltakerne Nordblad, docent, STAKES


Hvordan kan vi styrke ergoterapi og utvikle kvaliteten i fagutøvelsen?

Hvordan kan vi styrke ergoterapi og utvikle kvaliteten i fagutøvelsen? Hvordan kan vi styrke ergoterapi og utvikle kvaliteten i fagutøvelsen? Abstract Kunnskapsbasert praksis innebærer å ta faglige avgjørelser basert på systematisk innhentet forskningskunnskap, erfaringsbasert


Bakgrunn og organisatorisk forankring for prosjektet

Bakgrunn og organisatorisk forankring for prosjektet Utviklingsprosjekt: Implementering og effekt av å ta i bruk pasientforløp og kliniske retningslinjer. Nasjonalt topplederprogram Helle Schøyen Kull 14 Helse Stavanger 1 Bakgrunn og organisatorisk forankring


Kunnskapssenteret - hva kan vi tilby psykisk helse feltet?

Kunnskapssenteret - hva kan vi tilby psykisk helse feltet? Kunnskapsesenterets nye PPT-mal Kunnskapssenteret t - hva kan vi tilby psykisk helse feltet? Fagseminar DM 11.november 2010 Gro Jamtvedt, avdelingsdirektør Kunnskapsesenterets nye PPT-mal Visjon: God kunnskap


Introduksjon til kunnskapsbasert praksis og oppsummert forskning på sosialt arbeid i somatiske sykehus. Rigmor C Berg 29.

Introduksjon til kunnskapsbasert praksis og oppsummert forskning på sosialt arbeid i somatiske sykehus. Rigmor C Berg 29. Introduksjon til kunnskapsbasert praksis og oppsummert forskning på sosialt arbeid i somatiske sykehus Rigmor C Berg 29. september 2016 Agenda 1. Hva er kunnskapsbasert praksis? 2. Hva trengs for å jobbe


Bokmelding. Terje Ogden Evidensbasert praksis i arbeidet med barn og unge Oslo: Gyldendal forlag

Bokmelding. Terje Ogden Evidensbasert praksis i arbeidet med barn og unge Oslo: Gyldendal forlag Bokmelding Terje Ogden Evidensbasert praksis i arbeidet med barn og unge Oslo: Gyldendal forlag Terje Ogden har skrevet en instruktiv og passelig lettlest bok om et tema som har vakt til dels heftig debatt


Hvordan kvalitetsvurderer vi

Hvordan kvalitetsvurderer vi Hvordan kvalitetsvurderer vi forskningsartikler? Niels Gunnar Juel, seniorrådgiver/lege, Kunnskapssenteret Hva skal vi bruke tiden til? 1. time Ulike studiedesign - når bruker vi dem Vurdering av enkeltstudier


Kunnskapsbasert HPV vaksinering Kan motstanden lenger forsvares? Ingvil Sæterdal, forsker

Kunnskapsbasert HPV vaksinering Kan motstanden lenger forsvares? Ingvil Sæterdal, forsker Kunnskapsbasert HPV vaksinering Kan motstanden lenger forsvares? Ingvil Sæterdal, forsker Nytt tiltak Ikke nyttig Metodevurdering Entusiasme Overbevisning Press Nyttig Helsetjenestetilbud 31. august 2015


Evidensbasert sykepleie - en farbar vei?

Evidensbasert sykepleie - en farbar vei? Evidensbasert sykepleie - en farbar vei? Evidensbasert praksis løsning, tragedie eller noe midt i mellom? Hva er evidensbasert medisin/sykepleie? EBM is the conscientious, explicit, and judicious use of



BARNS DELTAKELSE I EGNE BARNS DELTAKELSE I EGNE BARNEVERNSSAKER Redd barnas barnerettighetsfrokost 08.09.2011 Berit Skauge Master i sosialt arbeid HOVEDFUNN FRA MASTEROPPGAVEN ER DET NOEN SOM VIL HØRE PÅ MEG? Dokumentgjennomgang


R&A-legene, rusfeltet og de andre profesjonene

R&A-legene, rusfeltet og de andre profesjonene R&A-legene, rusfeltet og de andre profesjonene Randi Ervik, Diakonhjemmet høgskole Soria Moria, 31.10.14 Narkotikakontroll medisinsk perspektiv. I Norge, som i storparten av Europa, var kontrollen med


Kunnskapsesenterets nye PPT-mal

Kunnskapsesenterets nye PPT-mal Bodø 6. desember 2012 Kvalitetsvurdering av forskningsartikler Kunnskapsesenterets nye PPT-mal - Det er ikke gull i alt som glitrer Elisabeth Jeppesen, forsker, Nasjonalt kunnskapssenter for helsetjenesten,


Hvordan finne kunnskap om akuttpsykiatri?

Hvordan finne kunnskap om akuttpsykiatri? Hvordan finne kunnskap om akuttpsykiatri? Akuttnettverket, Gardermoen 30.april 2013 Monica Stolt Pedersen Forskningsbibliotekar Sykehuset Innlandet HF Avdeling for kunnskapsstøtte/bibliotektjenesten E-post:


Kollektiv kompetanseutvikling i videregående pplæring. Thomas Nordahl 19.08.15

Kollektiv kompetanseutvikling i videregående pplæring. Thomas Nordahl 19.08.15 Kollektiv kompetanseutvikling i videregående pplæring Thomas Nordahl 19.08.15 Utfordringer i videregående opplæring handler ikke om organisering eller insentiver, men primært om kompetanse hos lærere og


Forskning versus kvalitetsforbedring - bruk av kunnskap fra (kvalitets-) registre til å forbedre tjenesten

Forskning versus kvalitetsforbedring - bruk av kunnskap fra (kvalitets-) registre til å forbedre tjenesten Forskning versus kvalitetsforbedring - bruk av kunnskap fra (kvalitets-) registre til å forbedre tjenesten Anne Grimstvedt Kvalvik, Seniorrådgiver, dr.med., Fagavd., Helse Vest RHF. Lovverk Teknologiske


Stabilisering av columna

Stabilisering av columna Norwegian trauma competency service Stabilisering av columna Metode, fremgangsmåte og resultat Elisabeth Jeppesen MPH, PhD Beskyttelse av columna - historikk 80 tallet: under bokstaven A i ATLS primærundersøkelse


IInternasjonale prosesser vedrørende metodevurderinger

IInternasjonale prosesser vedrørende metodevurderinger IInternasjonale prosesser vedrørende metodevurderinger Seminar i metodevurdering Torsdag 29. januar 2015 Øyvind Melien, sekretariatet nasjonalt system, Helsedirektoratet World Health Organization Resolusjon


Evidens-basert praksis Kunnskapsbasert praksis Evidence based practice

Evidens-basert praksis Kunnskapsbasert praksis Evidence based practice Evidens-basert praksis Kunnskapsbasert praksis Evidence based practice Kåre Birger Hagen Nasjonalt Revmatologisk Rehabilterings- og Kompetansesenter, Diakonhjemmets Sykehus kare.birger.hagen@nrrk.no Disposisjon


Om betydningen av offentlig informasjon om behandlingsbeslutninger.

Om betydningen av offentlig informasjon om behandlingsbeslutninger. Om betydningen av offentlig informasjon om behandlingsbeslutninger. Den nasjonale helseøkonomikonferansen 2013 Solstrand Geir Godager 0: Innledning Utgangspunkt for dagens presentasjon: Laboratorieeksperiment


Studieplan for program: Prestasjonsutvikling i skytingdeltid

Studieplan for program: Prestasjonsutvikling i skytingdeltid Studieplan for program: Prestasjonsutvikling i skytingdeltid (PSD) 30 studiepoeng Innledning Studiet Prestasjonsutvikling i skyting - deltid fokuserer på ulike aspekter som ligger til grunn for å heve


Perifer venekanyle: Innleggelse, vedlikehold og fjerning - METODERAPPORT

Perifer venekanyle: Innleggelse, vedlikehold og fjerning - METODERAPPORT Perifer venekanyle: Innleggelse, vedlikehold og fjerning - METODERAPPORT Metoderapporten er felles for prosedyrene om innleggelse av PVK, vedlikehold av PVK og fjerning av PVK. Formålet med prosedyrene:


Screening- og kartleggingsverktøy for utsatte barn Database i Helsebiblioteket

Screening- og kartleggingsverktøy for utsatte barn Database i Helsebiblioteket Screening- og kartleggingsverktøy for utsatte barn Database i Helsebiblioteket Monica Martinussen RBUP-Nord Universitetet i Tromsø Database over måleinstrumenter Bakgrunn for prosjektet: Helsedirektoratet


Praksisstudier i sykepleie med fokus på helsefremming og brukermedvirkning: Kommunehelsetjeneste og kirurgisk felt

Praksisstudier i sykepleie med fokus på helsefremming og brukermedvirkning: Kommunehelsetjeneste og kirurgisk felt Praksisstudier i sykepleie med fokus på helsefremming og brukermedvirkning: Kommunehelsetjeneste og kirurgisk felt Emnekode: BSYP5D_1, Vekting: 20 studiepoeng Tilbys av: Det samfunnsvitenskapelige fakultet,


Rehabiliteringskonferansen oktober 2013

Rehabiliteringskonferansen oktober 2013 Rehabiliteringskonferansen oktober 2013 Mål og visjoner og satsning 2008/ 2009 Erfaringer - breddes ut og videreutvikles 2013 Satser videre på: - Kompetanse - Forankring - Ivaretakelse - Samarbeid SAMARBEIDSPROSJEKT


Lærerprofesjonalitet i endring. - nye forventninger, ulike svar. Sølvi Mausethagen Senter for profesjonsstudier solvi.mausethagen@hioa.

Lærerprofesjonalitet i endring. - nye forventninger, ulike svar. Sølvi Mausethagen Senter for profesjonsstudier solvi.mausethagen@hioa. Lærerprofesjonalitet i endring - nye forventninger, ulike svar Sølvi Mausethagen Senter for profesjonsstudier solvi.mausethagen@hioa.no Innlandets utdanningskonferanse 11.mars 2014 Kamp om lærerprofesjonaliteten


Kysthospitalet i Stavern - Brukerkunnskap i behandlingslinjen

Kysthospitalet i Stavern - Brukerkunnskap i behandlingslinjen Kysthospitalet i Stavern - Brukerkunnskap i behandlingslinjen 12. Juni 2013 Monica F. Petersson Kysthospitalet i Stavern Foto: SiV HF, Kysthospitalet Design er brukerdrevet innovasjon i praksis Designmetodikk


Forskningsmetoder i informatikk

Forskningsmetoder i informatikk Forskningsmetoder i informatikk Forskning; Masteroppgave + Essay Forskning er fokus for Essay og Masteroppgave Forskning er ulike måter å vite / finne ut av noe på Forskning er å vise HVORDAN du vet/ har


Enteralernæring METODERAPPORT

Enteralernæring METODERAPPORT Enteralernæring METODERAPPORT Metoderapporten er felles for prosedyrene om generelt om enteralernæring, administrering av enteralernæring, administrering av legemidler i sonde, og vedlikehold av sonde.


Kunnskapssenterets rolle på nye PPT-mal. legemiddelområdet

Kunnskapssenterets rolle på nye PPT-mal. legemiddelområdet Kurs i samfunnsfarmakologi, 24. november Kunnskapsesenterets Kunnskapssenterets rolle på nye PPT-mal legemiddelområdet Ingvil Sæterdal, forsker Nasjonalt kunnskapssenter for helsetjenesten 1. desember


Komplekse intervensjoner Metodiske utfordringer. Liv Wensaas PhD, RN, Leder for FOU enheten Helse og omsorg Asker kommune

Komplekse intervensjoner Metodiske utfordringer. Liv Wensaas PhD, RN, Leder for FOU enheten Helse og omsorg Asker kommune Komplekse intervensjoner Metodiske utfordringer Liv Wensaas PhD, RN, Leder for FOU enheten Helse og omsorg Asker kommune DISPOSISJON Intervensjonsforskning og helsefag Komplekse intervensjoner Metodiske


Høringsuttalelse fra Atferdssenteret

Høringsuttalelse fra Atferdssenteret Forskningsrådet: Innovasjon i offentlig sektor policy Høringsuttalelse fra Atferdssenteret Innledning Atferdssenteret (Norsk senter for studier av problematferd og innovativ praksis) er opprettet av tre


Studieplan for videreutdanning i Kunnskapsbasert Ergoterapi

Studieplan for videreutdanning i Kunnskapsbasert Ergoterapi Studieplan for videreutdanning i Kunnskapsbasert Ergoterapi Modul 1: Søk etter kunnskap - 5 studiepoeng/ects Modul 2: Kritisk vurdering og anvendelse av kunnskap 5 studiepoeng/ects Program for ergoterapeututdanning


Brystkreft: hyppigheten øker men dødeligheten går ned hvorfor? Lars Vatten, dr med Professor i epidemiologi. Det medisinske fakultet NTNU, Trondheim

Brystkreft: hyppigheten øker men dødeligheten går ned hvorfor? Lars Vatten, dr med Professor i epidemiologi. Det medisinske fakultet NTNU, Trondheim Brystkreft: hyppigheten øker men dødeligheten går ned hvorfor? Lars Vatten, dr med Professor i epidemiologi Det medisinske fakultet NTNU, Trondheim 1 Dødelighetskurven for brystkreft viste en svakt økende


Veiledning og vurdering av Bacheloroppgave for Informasjonsbehandling

Veiledning og vurdering av Bacheloroppgave for Informasjonsbehandling Veiledning og vurdering av Bacheloroppgave for Informasjonsbehandling Oppdatert 15. jan. 2014, Svend Andreas Horgen (studieleder Informasjonsbehandling og itfag.hist.no) Her er noen generelle retningslinjer


Barnevern i Norden om ti år ny balanse mellom velferd og beskyttelse? Elisabeth Backe-Hansen, NOVA

Barnevern i Norden om ti år ny balanse mellom velferd og beskyttelse? Elisabeth Backe-Hansen, NOVA Barnevern i Norden om ti år ny balanse mellom velferd og beskyttelse? Elisabeth Backe-Hansen, NOVA PAGE 1 Innholdet i foredraget Velferdsstaten og barnevernet Barnevernet og marginalisering Barnevernet


IDRI3001 Bacheloroppgave i Drift av datasystemer

IDRI3001 Bacheloroppgave i Drift av datasystemer IDRI3001 Bacheloroppgave i Drift av datasystemer Kjell Toft Hansen, 15.04.2015 Bachelor Informatikk Drift av datasystemer Sammendrag Her er noen studiespesifikke retningslinjer for veiledning og vurdering


forord Marianne Storm

forord Marianne Storm Forord Arbeidet med å utvikle metodikken som utgjør tiltaket «Brukermedvirkning i praksis», begynte som et ønske om å sette fokus på hva brukermedvirkning er i konkrete handlinger, og i samhandling mellom


Kunnskapsbasert praksis og kunnskapsbasert opplæring for å sikre kvalitet. Nora Frydendal Hoem

Kunnskapsbasert praksis og kunnskapsbasert opplæring for å sikre kvalitet. Nora Frydendal Hoem Kunnskapsbasert praksis og kunnskapsbasert opplæring for å sikre kvalitet Nora Frydendal Hoem Hva bygger vi vår kunnskap på? Det vi har lært på skolen Det vi har erfart virker Det som er bestemt på avdelingen
