Regularitati ascunse si corelatii in nano-bio-structuri

Størrelse: px
Begynne med side:

Download "Regularitati ascunse si corelatii in nano-bio-structuri"

Transkript

1 NATIONAL INSTITUTE OF MATERIALS PHYSICS BUCHAREST-MAGURELE Atomistilor Str. bis, P.O. Box MG-7, 77 Magurele-Ilfov, Romania Phone: +() 98, Fax: +() 977, Regularitati ascunse si corelatii in nano-bio-structuri M. Popescu, A. Velea Workshop Exploratoriu: "Nano Sisteme Dinamice: de la Concepte la Aplicatii Senzoristice" - septembrie, Bucuresti

2 Cuprins Introducere Metode Colagen α(i) uman Interferon β Concluzii

3 Introducere

4 Metode Pair correlation - Se calculeaza numarul de perechi de aminoacizi de acelasi fel situati la anumite distante unul de celalalt - Se determina functia de corelare de perechi Fast Fourier Transform A X t A n t B n t () = + ncos( ω ) + nsin( ω ) n= n= ω = π T + T / ( ) = ( n + n) = ( ) T f = inωt G f A ib X t e dt T / nω

5 Colagen α(i) uman 7 V Y W T S 78 P 7 F M 7 K 8 L I 9 H 9 G 7 E 9 Q 8 C D 8 N 7 R 9 A MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVW KPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQ ETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLG GNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGE PGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPG TAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLP GERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGP QGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAG APGFPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQ GPPGPAGEEGKRGARGEPGPTGLPGPPGERGGPGSRGFPGADGVAGPKGP AGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGP AGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPPGAVG PAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKP GEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGA KGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPG KDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPGDRGEPGPPG PAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIGNVGAPG AKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGKGPR GETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVV GLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGE SGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAG KSGDRGETGPAGPTGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHR GFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPI GPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGG RYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCH SDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNP KDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHC KNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWG KTVIEYKTTKTSRLPIIDVAPLDVGAPDQEFGFDVGPVCFL aminoacizi COA_HUMAN P

6 B Pozitionari in lant: Colagen α(i) uman. Alanine. Arginine. Aspartate. Aspargine. Cysteine Chain Postion Glutamate. Glutamine. Glycine. Histidine. Isoleucine Leucine. Lysine. Methionine. Phenyalanine. Proline Serine. Threonine. Tryptophan. Tyrosine. Valine

7 Colagen α(i) uman FFT:. Alanine. Arginine. Aspargine. Aspartate. Cysteine Glutamate.. Glutamine.. Glycine.. Histidine.. Isoleucine Leucine. Lysine... Methionine.... Phenyalanine.. Proline Serine. Threonine.8 Tryptophan. Tyrosine. Valine

8 Colagen α(i) uman Distante intre aminoacizi de acelasi tip: Alanine Arginine Aspargine.. Tyrosine. Aspartate Cysteine.. Glutamate Glutamine Glycine Histidine Isoleucine. 7 Leucine Lysine 7 Methionine. Phenyalanine Proline Serine 8 7 Threonine Tryptophan..8 Valine

9 Colagen α(i) uman Probabilitati de legare intre doi aminoacizi X si Y in lantul de colagen α(i) uman : Pr ob = LegXY NrX + LegYX + NrY LegXY= nr de legaturi X-Y LegYX= nr de legaturi Y-X NrX= numarul de aminoacizi X din lantul colagenului NrY= numarul de aminoacizi Y din lantul colagenului

10 Interferon β IFNB_HUMAN P7 V Y W T S P F M K L I H G E Q C D N R 8 A MTNKCLLQIALLLCFSTTAL SMSYNLLGFLQRSSNFQC QKLLWQLNGRLEYCLKDR MNFDIPEEIKQLQQFQKED AALTIYEMLQNIFAIFRQDS SSTGWNETIVENLLANVY HQINHLKTVLEEKLEKEDF TRGKLMSSLHLKRYYGRIL HYLKAKEYSHCAWTIVRV EILRNFYFINRLTGYLRN 87 aminoacizi

11 Interferon β Pozitionari in lant:. Alanine. Arginine. Aspargine. Aspartate. Cysteine Glutamate. Glutamine. Glycine. Histidine. Isoleucine Chin Position Leucine. Lysine. Methionine. Phenylalanine. Proline Serine. Threonine. Tryptophan. Tyrosine. Valine

12 Interferon β FFT:.8 Alanine.8 Arginine.8 Aspargine. Aspartate. Cysteine Glutamate.8 Glutamine.. Glycine.. Histidine.8 Isoleucine Leucine.8 Lysine. Methionine.8 Phenylalanine. Proline Serine.8.8 Threonine. Tryptophan.8 Tyrosine. Valine

13 Concluzii Aplicarea metodelor statistice in moleculele cu lanturi mari permite obtinerea de argumente pentru ordonarea partiala a aminoacizilor si obtinerea de corelatii intre aminoacizi. Atunci cand aminoacizii sunt folositi pentru construirea unor lanturi lungi si complicate metodele statistice sunt eficiente pentru dezvaluirea structurii primare a biomoleculelor.

14 Va multumesc pentru atentie!

Purasana Myseprotein pulver Whey Natural 400 g boks

Purasana Myseprotein pulver Whey Natural 400 g boks Purasana Myseprotein pulver Whey Natural 400 g boks Purasana Myseprotein pulver Whey Natural 400 g boks 6388 Ingen forbindelse Økologisk, lettopptagelig, naturlig proteinpulver av myse, uten tilsatt smak,

Detaljer

Aminosyresammensetning i korn

Aminosyresammensetning i korn 230 M. Åssveen / Grønn kunnskap 9 (2) Aminosyresammensetning i korn Mauritz Åssveen / mauritz.aassveen@planteforsk.no Planteforsk Apelsvoll forskingssenter Bakgrunn Den overveiende delen av bygg og havre

Detaljer

Torskenettverkskonferansen 9. og 10. februar 2011

Torskenettverkskonferansen 9. og 10. februar 2011 Torskenettverkskonferansen 9. og 10. februar 2011 Oddrun Anita Gudbrandsen Forsker ved Institutt for indremedisin Universitetet i Bergen nkjgu@med.uib.no Tlf 55 97 55 53 På grunn av internasjonale regler

Detaljer

FYS 3710 Biofysikk og Medisinsk Fysikk, Aminosyrer, Polypeptider, Proteiner

FYS 3710 Biofysikk og Medisinsk Fysikk, Aminosyrer, Polypeptider, Proteiner FYS 3710 Biofysikk og Medisinsk Fysikk, 2016 5 Aminosyrer, Polypeptider, Proteiner Einar Sagstuen, Fysisk institutt, UiO 06.09.2016 1 sp n -hybridisering: for hovedkvantetall N=2 er de fire valensorbitalene

Detaljer

Biologien og mennesket. Biologiens tidlige historie. Charles Robert Darwin ( ) Evolusjon gav biologien en historisk dimensjon

Biologien og mennesket. Biologiens tidlige historie. Charles Robert Darwin ( ) Evolusjon gav biologien en historisk dimensjon Evolusjon gav biologien en historisk dimensjon Biologien og Mennesket Jens Ådne Rekkedal Haga CEES, UiO j.a.haga@bio.uio.no Biologien og mennesket Biologiens tidlige historie Naturen i mennesket Hvor mye

Detaljer

Aminosyreomsetning og urea-syklus. Medisinstudiet semester 1A Asbjørn Nilsen, IKM

Aminosyreomsetning og urea-syklus. Medisinstudiet semester 1A Asbjørn Nilsen, IKM Aminosyreomsetning og urea-syklus Medisinstudiet semester 1A Asbjørn Nilsen, IKM Aminosyreomsetning og ureasyklus Aminosyrer generelt Syntese av ikke-essensielle aminosyrer Nedbrytning av aminosyrer Utskilling

Detaljer

Introduksjon. Historikk. Teoriene. Behandling. Forskerne bak teoriene. Kroppens biokjemi, målinger, ubalanser. Ernærings tilskudd og diett

Introduksjon. Historikk. Teoriene. Behandling. Forskerne bak teoriene. Kroppens biokjemi, målinger, ubalanser. Ernærings tilskudd og diett Introduksjon Formålet med foredraget Historikk Forskerne bak teoriene Teoriene Kroppens biokjemi, målinger, ubalanser Behandling Ernærings tilskudd og diett Mette Sophie Johnsgaard Allmennlege, MNLF Allmennlege

Detaljer

Ernæringsterapi. Aminosyrer. Aminosyrer. Aminosyrer (2) Aminosyrer (3) Signalstoffer. Neurotransmittere- signalstoffer. Jens Veiersted 12.08.

Ernæringsterapi. Aminosyrer. Aminosyrer. Aminosyrer (2) Aminosyrer (3) Signalstoffer. Neurotransmittere- signalstoffer. Jens Veiersted 12.08. Byggestener i kroppen Stort organisk molekyl Inneholder En syre gruppe COOH En amino gruppe NH 2 Er alltid et hvitt krystallinsk pulver Løses i vann Har mange oppgaver i kroppen Alle 8 essensielle må være

Detaljer

Marine Proteiner - effekter på muskelmasse og fettlagring. Oddrun Anita Gudbrandsen Institutt for indremedisin, UiB nkjgu@med.uib.

Marine Proteiner - effekter på muskelmasse og fettlagring. Oddrun Anita Gudbrandsen Institutt for indremedisin, UiB nkjgu@med.uib. Marine Proteiner - effekter på muskelmasse og fettlagring Oddrun Anita Gudbrandsen Institutt for indremedisin, UiB nkjgu@med.uib.no 1 www.helse-bergen.no 2 Norske anbefalinger for inntak (angitt som prosent

Detaljer

Marint protein teknologiske egenskaper og smaksutfordringer

Marint protein teknologiske egenskaper og smaksutfordringer Marint protein teknologiske egenskaper og smaksutfordringer Åge Oterhals Foredrag årsmøte Marint Protein Nettverk, Nofima Ås, 16. februar 2017 Pilot plant facilities (750 m 2 ) Nofima Bergen - Bioprocessing

Detaljer

Fra møte i faggruppen for ernæring, dietetiske produkter, ny mat og allergi

Fra møte i faggruppen for ernæring, dietetiske produkter, ny mat og allergi Protokoll Fra møte i faggruppen for ernæring, dietetiske produkter, ny mat og allergi Dato: 15.12.15, kl. 10:00-15:00 Sted: VKM, møterom i 2. etg Møteleder: Per Ole Iversen Deltakere Fra faggruppen: Per

Detaljer

ZINZINO. Helse konsept.

ZINZINO. Helse konsept. ZINZINO Helse konsept www.izinzino.com De fleste ønsker å spise sunt, komme i form eller gå ned i vekt Den vanligste helseanbefalingen er å være i fysisk aktivitet. HVORFOR? Fordi det bygger muskler og

Detaljer

Biostimulanter. Hokus pokus eller målbare effekter? Creating value, growing together

Biostimulanter. Hokus pokus eller målbare effekter? Creating value, growing together Biostimulanter Hokus pokus eller målbare effekter? Creating value, growing together Biostimulanter Hva er biostimulanter Hvordan virker de Acadian Tangekstrakt Aminosol Hva kan vi oppnå med bruk av Acadian

Detaljer

1. LEGEMIDLETS NAVN. Glavamin 22,4 g N/l infusjonsvæske, oppløsning 2. KVALITATIV OG KVANTITATIV SAMMENSETNING

1. LEGEMIDLETS NAVN. Glavamin 22,4 g N/l infusjonsvæske, oppløsning 2. KVALITATIV OG KVANTITATIV SAMMENSETNING 1. LEGEMIDLETS NAVN Glavamin 22,4 g N/l infusjonsvæske, oppløsning 2. KVALITATIV OG KVANTITATIV SAMMENSETNING 1000 ml Glavamin infusjonsvæske inneholder: Alanin Arginin Aspartinsyre Fenylalanin Glutaminsyre

Detaljer

Ernæringsbehandlingavmedfødte metabolskesykdommer. 30.09.11 Rina Lilje Klinisk ernæringsfysiolog

Ernæringsbehandlingavmedfødte metabolskesykdommer. 30.09.11 Rina Lilje Klinisk ernæringsfysiolog Ernæringsbehandlingavmedfødte metabolskesykdommer 30.09.11 Rina Lilje Klinisk ernæringsfysiolog Ulikediettprinsipper Individuelt tilpassede restriksjoner: Ulikgrad avproteinrestriksjon; PKU, Tyrosinemitype

Detaljer

Utkast til forskrift om endring i forskrift om tilsetning av vitaminer, mineraler og visse andre stoffer til næringsmidler

Utkast til forskrift om endring i forskrift om tilsetning av vitaminer, mineraler og visse andre stoffer til næringsmidler Utkast til forskrift om endring i forskrift om tilsetning av vitaminer, mineraler og visse andre stoffer til næringsmidler Hjemmel: Fastsatt av Helse- og omsorgsdepartementet XX. XXXX 20XX med hjemmel

Detaljer

1000 ml inneholder: Aminosyrer: 114 g, hvorav 51,6 g er essensielle (inkludert cystein og tyrosin). Nitrogen: 18 g. Elektrolytter: Ca 110 mmol acetat.

1000 ml inneholder: Aminosyrer: 114 g, hvorav 51,6 g er essensielle (inkludert cystein og tyrosin). Nitrogen: 18 g. Elektrolytter: Ca 110 mmol acetat. 1. LEGEMIDLETS NAVN Vamin 18 g N/l Elektrolyttfri infusjonsvæske, oppløsning 2. KVALITATIV OG KVANTITATIV SAMMENSETNING 1000 ml Vamin 18 g N/l Elektrolyttfri inneholder: Alanin Arginin Aspartinsyre Cystein

Detaljer

Kvalitet av økologisk dyrka proteinvekstar til kraftfôr for drøvtyggarar og fjørfe

Kvalitet av økologisk dyrka proteinvekstar til kraftfôr for drøvtyggarar og fjørfe Kvalitet av økologisk dyrka proteinvekstar til kraftfôr for drøvtyggarar og fjørfe Husdyrforsøksmøtet 2009 Britt I. F. Henriksen, Egil Prestløkken, Aina R. Lundon Organic protein feed and edible oil form

Detaljer

PRODUKTOVERSIKT KETOGEN KOST AMINOSYRER SPESIALPRODUKTER

PRODUKTOVERSIKT KETOGEN KOST AMINOSYRER SPESIALPRODUKTER PRODUKTOVERSIKT KETOGEN KOST AMINOSYRER SPESIALPRODUKTER 2018 INNHOLD SIDE Monogen 4 Kindergen 4 Locasol 5 Galactomin 17 5 Galactomin 19 5 KetoCal 16 KetoCal 4:1 LQ (Multi Fibre) 17 Calogen Nøytral 23

Detaljer

Proteiner og proteinstrukturer

Proteiner og proteinstrukturer Medisin stadium 1A Geir Slupphaug, IKM Proteiner og proteinstrukturer Alle proteiner er bygd opp av aminosyrer. Dette er en gruppe organiske molekyler som inneholder både en karboksylsyregruppe (-COOH)

Detaljer

Proteiner og aminosyrer

Proteiner og aminosyrer Proteiner og aminosyrer Presentasjonsplan 1/2 Cellen Grunnleggende komponenter DNA til mrna til proteiner Den genetiske koden: Hva er et codon? Presentasjonsplan 2/2 Aminosyrer del 1 Hvilke molekyler er

Detaljer

EØS-KOMITEENS BESLUTNING nr. 80/2018 av 27. april 2018 om endring av EØS-avtalens vedlegg I (Veterinære og plantesanitære forhold)

EØS-KOMITEENS BESLUTNING nr. 80/2018 av 27. april 2018 om endring av EØS-avtalens vedlegg I (Veterinære og plantesanitære forhold) EØS-KOMITEENS BESLUTNING nr. 80/2018 av 27. april 2018 om endring av EØS-avtalens vedlegg I (Veterinære og plantesanitære forhold) EØS-KOMITEEN HAR under henvisning til avtalen om Det europeiske økonomiske

Detaljer

Side 1 ARBEIDSBESKRIVELSE Institutt for husdyr- og akvakulturvitenskap, NMBU

Side 1 ARBEIDSBESKRIVELSE Institutt for husdyr- og akvakulturvitenskap, NMBU 1 EIDSBESKRIVELSE Institutt for husdyr- og akvakulturvitenskap, NMBU Metodenavn: Aminosyreanalyse - oksiderte prøver BIOVIT-nr: Arb1050 1. Innledning/hensikt Metoden bestemmer totalinnholdet (peptid-bunnede

Detaljer

Sykdomstilstander hos barn hvor den orale eller enterale næringstilførsel er utilstrekkelig eller ikke gjennomførbar.

Sykdomstilstander hos barn hvor den orale eller enterale næringstilførsel er utilstrekkelig eller ikke gjennomførbar. 1. LEGEMIDLETS NAVN Vaminolac infusjonsvæske, oppløsning 2. KVALITATIV OG KVANTITATIV SAMMENSETNING 1000 ml Vaminolac infusjonsvæske inneholder: Alanin Arginin Aspartinsyre Cystein/cystin Glutaminsyre

Detaljer

OMXtra. Fermented Food. Den mest avanserte formelen noensinne med det beste fra naturen. Et maksimalt fungerende tarmsystem gir:

OMXtra. Fermented Food. Den mest avanserte formelen noensinne med det beste fra naturen. Et maksimalt fungerende tarmsystem gir: OMXtra Fermented Food Den mest avanserte formelen noensinne med det beste fra naturen. Et maksimalt fungerende tarmsystem gir: God helse Optimal livskvalitet Vakker hud Uendelig energi Øket vitalitet Bedre

Detaljer

Risikogruppering av aminosyrer Uttalelse fra Faggruppe for ernæring, dietetiske produkter, ny mat og allergi i Vitenskapskomiteen for mattrygghet

Risikogruppering av aminosyrer Uttalelse fra Faggruppe for ernæring, dietetiske produkter, ny mat og allergi i Vitenskapskomiteen for mattrygghet Risikogruppering av aminosyrer Uttalelse fra Faggruppe for ernæring, dietetiske produkter, ny mat og allergi i Vitenskapskomiteen for mattrygghet Dato: 28.11.11 Dok. nr.: 09-703-endelig ISBN: 978-82-8259-031-0

Detaljer

Proteiner og proteinstrukturer

Proteiner og proteinstrukturer Medisin stadium 1A Geir Slupphaug, IKM Proteiner og proteinstrukturer Alle proteiner er bygd opp av aminosyrer. Dette er en gruppe organiske molekyler som inneholder både en karboksylsyregruppe (-) og

Detaljer

Figurer og diagrammer

Figurer og diagrammer Figurer og diagrammer Aminor Stort organisk molekyl En gruppe COOH En amino gruppe NH Et hvitt krystallinsk pulver Løses i vann Har mange oppgaver i kroppen Alle 8 essensielle må være til stede for å bygge

Detaljer

Side 1 ARBEIDSBESKRIVELSE Institutt for husdyr- og akvakulturvitenskap, UMB

Side 1 ARBEIDSBESKRIVELSE Institutt for husdyr- og akvakulturvitenskap, UMB 1 EIDSBESKRIVELSE Institutt for husdyr- og akvakulturvitenskap, UMB Metodenavn: Aminosyreanaly - oksiderte prøver IHA-nr:1050 1. Innledning/hensikt Metoden bestemmer totalinnholdet (peptidbundede og frie)

Detaljer

Risikogruppering av aminosyrer Uttalelse fra Faggruppe for ernæring, dietetiske produkter, ny mat og allergi i Vitenskapskomiteen for mattrygghet

Risikogruppering av aminosyrer Uttalelse fra Faggruppe for ernæring, dietetiske produkter, ny mat og allergi i Vitenskapskomiteen for mattrygghet Risikogruppering av aminosyrer Uttalelse fra Faggruppe for ernæring, dietetiske produkter, ny mat og allergi i Vitenskapskomiteen for mattrygghet Dato: 28.11.11 Dok. nr.: 09-703-endelig ISBN: 978-82-8259-031-0

Detaljer

Innhold av virkestoffer i 1000 ml og 2000 ml av preparatet før og etter blanding av de to kamrene i pakningen: Før blanding blanding

Innhold av virkestoffer i 1000 ml og 2000 ml av preparatet før og etter blanding av de to kamrene i pakningen: Før blanding blanding PREPARATOMTALE 1 1. LEGEMIDLETS NAVN Nutriflex plus infusjonsvæske, oppløsning 2. KVALITATIV OG KVANTITATIV SAMMENSETNING Innhold av virkestoffer i 1000 ml og 2000 ml av preparatet før og etter blanding

Detaljer

Innhold av virkestoffer i 1000 ml og 1500 ml av preparatet før og etter blanding av de to kamrene i pakningen: Før blanding blanding

Innhold av virkestoffer i 1000 ml og 1500 ml av preparatet før og etter blanding av de to kamrene i pakningen: Før blanding blanding PREPARATOMTALE 1 1. LEGEMIDLETS NAVN Nutriflex special infusjonsvæske, oppløsning 2. KVALITATIV OG KVANTITATIV SAMMENSETNING Innhold av virkestoffer i 1000 ml og 1500 ml av preparatet før og etter blanding

Detaljer

Rapport nr. 301/50 FISKEENSILASJE I KRAFTFÔR TIL HUSDYR Hovedrapport

Rapport nr. 301/50 FISKEENSILASJE I KRAFTFÔR TIL HUSDYR Hovedrapport Rapport nr. 301/50 FISKEENSILASJE I KRAFTFÔR TIL HUSDYR Hovedrapport RAPPORT-TITTEL FISKEENSILASJE I KRAFTFÔR TIL HUSDYR RAPPORTNUMMER 301/50 PROSJEKTNUMMER 301 UTGIVER RUBIN DATO Januar 1996 UTFØRENDE

Detaljer

Behov for energi og protein/lysintilførsel til rasktvoksende slaktegris. Victoria Bøhn Lund Fagrådgiver Svin, Felleskjøpet Agri

Behov for energi og protein/lysintilførsel til rasktvoksende slaktegris. Victoria Bøhn Lund Fagrådgiver Svin, Felleskjøpet Agri Behov for energi og protein/lysintilførsel til rasktvoksende slaktegris Victoria Bøhn Lund Fagrådgiver Svin, Felleskjøpet Agri Produktivitetsutviklingen har vært enorm! 2,78 2,76 2,76 2,74 2,72 2,73 2,71

Detaljer

(12) Oversettelse av europeisk patentskrift

(12) Oversettelse av europeisk patentskrift (12) Oversettelse av europeisk patentskrift (11) NO/EP 68909 B1 (19) NO NORGE (1) Int Cl. A61K 38/18 (06.01) A61K 47/48 (06.01) C07K 14/0 (06.01) C12N 1/21 (06.01) C12N / (06.01) C12N 1/18 (06.01) C12N

Detaljer

MSUD, IVA, MMA/PA =Organiske acidurier. Trine Tangeraas, sept 2017

MSUD, IVA, MMA/PA =Organiske acidurier. Trine Tangeraas, sept 2017 MSUD, IVA, MMA/PA =Organiske acidurier Trine Tangeraas, sept 2017 Hva skal jeg snakke om: Hva er og hvorfor heter det organiske acidurier= MSUD, IVA, MMA/PA. Litt biokjemi, hva er felles for sykdommene

Detaljer

Utkast til forskrift om endring i forskrift om tilsetning av vitaminer, mineraler og visse andre stoffer til næringsmidler

Utkast til forskrift om endring i forskrift om tilsetning av vitaminer, mineraler og visse andre stoffer til næringsmidler Utkast til forskrift om endring i forskrift om tilsetning av vitaminer, mineraler og visse andre stoffer til næringsmidler Hjemmel: Fastsatt av Helse- og omsorgsdepartementet XX. XXXX 2019 med hjemmel

Detaljer

RelEx v. 1.0 (2004) Michael J. MacCoss and John D. Venable, The Scripps Research Institute, La Jolla, CA (2002)

RelEx v. 1.0 (2004) Michael J. MacCoss and John D. Venable, The Scripps Research Institute, La Jolla, CA (2002) RelEx v. 1.0 (2004) Michael J. MacCoss and John D. Venable, The Scripps Research Institute, La Jolla, CA (2002) P CE00015 locus:drs-1 Aspartyl-tRNA synthetase status:partially_confirm 0.876 0.074 7 R U

Detaljer

Fra møte i faggruppen for ernæring, dietetiske produkter, ny mat og allergi

Fra møte i faggruppen for ernæring, dietetiske produkter, ny mat og allergi Protokoll Fra møte i faggruppen for ernæring, dietetiske produkter, ny mat og allergi Dato: 30.08.16, kl. 10:00-15:00 Sted: VKM, Pilestredet Park 7A, 3+ etg. Møteleder: Per Ole Iversen Deltakere Fra faggruppen:

Detaljer

Gelatin fra selskinn Framstilling og karakterisering

Gelatin fra selskinn Framstilling og karakterisering RAPPORT 1/2001 Utgitt januar 2001 Gelatin fra selskinn Framstilling og karakterisering Jan Arne Arnesen og Asbjørn Gildberg Norut Gruppen er et konsern for anvendt forskning og utvikling og består av morselskap

Detaljer

Protokoll fra møte i Faggruppen for ernæring (human), dietetiske produkter, ny mat og allergi i VKM, tirsdag 28.08.07 kl. 10.00-15.

Protokoll fra møte i Faggruppen for ernæring (human), dietetiske produkter, ny mat og allergi i VKM, tirsdag 28.08.07 kl. 10.00-15. Dok.nr. 07-700-6 Protokoll fra møte i Faggruppen for ernæring (human), dietetiske produkter, ny mat og allergi i VKM, tirsdag 28.08.07 kl. 10.00-15.30 Deltakere Fra Faggruppen for ernæring (human), dietetiske

Detaljer

FRIMEDA TRANSPORTANKER SYSTEM TPA 06-N

FRIMEDA TRANSPORTANKER SYSTEM TPA 06-N FRIMEDA TRANSPORTANKER SYSTEM TPA 06-N BETONG TN -001-03/06 1.000 03/06 Halfen-Frimeda A/S Flintegata 4 4004 Stavanger NORWAY Phone: +47 51 823400 Fax: +47 51 823401

Detaljer

Tittel: FREMGANGSMÅTE FOR REDUKSJON AV BITTERHET OG FORBEDRING AV SMAK AV PROTEINFRI OG HYDROLYSERT MORSMELKERSTATNING

Tittel: FREMGANGSMÅTE FOR REDUKSJON AV BITTERHET OG FORBEDRING AV SMAK AV PROTEINFRI OG HYDROLYSERT MORSMELKERSTATNING (12) Oversettelse av europeisk patentskrift (11) NO/EP 20 B1 (19) NO NORGE (1) Int Cl. A23J 3/08 (06.01) A23J 3/ (06.01) A23J 3/32 (06.01) A23J 3/34 (06.01) A23L 1/29 (06.01) A23L 1/ (06.01) Patentstyret

Detaljer

UNIVERSITETET I OSLO

UNIVERSITETET I OSLO UNIVERSITETET I OSLO Side 1 Det matematisk-naturvitenskapelige fakultet Bokmål Eksamen i MBV 3010, Videregående cellebiologi. Eksamensdag: august 2006. Tid for eksamen: kl (3 timer). Oppgavesettet er på

Detaljer

PAKNINGSVEDLEGG. OLICLINOMEL N 6-900E, infusjonsvæske, emulsjon i trekammerpose. Virkestoffene er i pose på 1000 ml:

PAKNINGSVEDLEGG. OLICLINOMEL N 6-900E, infusjonsvæske, emulsjon i trekammerpose. Virkestoffene er i pose på 1000 ml: Ikke-proteinkalori/nitrogen-forhold (Kcal/g N) PAKNINGSVEDLEGG Vennligst les nøye gjennom dette pakningsvedlegget før du bruker legemidlet. -Ta vare på dette pakningsvedlegget. Du kan få behov for å lese

Detaljer

Kjemien stemmer KJEMI 2

Kjemien stemmer KJEMI 2 Figur s. 36 monosakkarid disakkarid polysakkarid Forenklede ringformler av tre grupper av sakkarider. Figur s. 37 2 Begge modellene viser strukturen av glukosemolekylet. Molekylet danner en seksring med

Detaljer

Innhold av virkestoffer i 1000 ml og 2000 ml av preparatet før og etter blanding av de to kamrene i pakningen: Før blanding blanding

Innhold av virkestoffer i 1000 ml og 2000 ml av preparatet før og etter blanding av de to kamrene i pakningen: Før blanding blanding PREPARATOMTALE 1 1. LEGEMIDLETS NAVN Nutriflex peri infusjonsvæske, oppløsning 2. KVALITATIV OG KVANTITATIV SAMMENSETNING Innhold av virkestoffer i 1000 ml og 2000 ml av preparatet før og etter blanding

Detaljer

Figurer kapittel 6: DNA er arvestoffet Figur s. 152

Figurer kapittel 6: DNA er arvestoffet Figur s. 152 BI Figurer kapittel 6: DN er arvestoffet Figur s. 152 kromosom DN-tråd ett gen vert DN-molekyl inneholder mange gener, og et gen er den delen av DN-et som inneholder informasjon om en egenskap. BI Figurer

Detaljer

RÅSTOFFANALYSE AV ROGN FRA NORSK VÅRGYTENDE SILD OG NORDSJØSILD. WENCHE EMBLEM LARSSEN Forsker

RÅSTOFFANALYSE AV ROGN FRA NORSK VÅRGYTENDE SILD OG NORDSJØSILD. WENCHE EMBLEM LARSSEN Forsker RÅSTOFFANALYSE AV ROGN FRA NORSK VÅRGYTENDE SILD OG NORDSJØSILD WENCHE EMBLEM LARSSEN Forsker 15.04.15 BAKGRUNN Det er gjennomført flere prosjekter med fokus på foredling av restråstoff fra sild til mer

Detaljer

Fra møte i faggruppen for ernæring, dietetiske produkter, ny mat og allergi

Fra møte i faggruppen for ernæring, dietetiske produkter, ny mat og allergi Protokoll Fra møte i faggruppen for ernæring, dietetiske produkter, ny mat og allergi Dato: 12.06.2017, kl. 10.00-14.30 Sted: Pilestredet Park 7, 4 etg, rom 428 Møteleder: Kristin Holvik Deltakere Fra

Detaljer

RÅSTOFFANALYSE AV ROGN FRA NORSK VÅRGYTENDE SILD OG NORDSJØSILD

RÅSTOFFANALYSE AV ROGN FRA NORSK VÅRGYTENDE SILD OG NORDSJØSILD RAPPORT MA 14-20 Wenche Emblem Larssen, Turid S. Fylling, Kristine Kvangarsnes og Trygg Barnung RÅSTOFFANALYSE AV ROGN FRA NORSK VÅRGYTENDE SILD OG NORDSJØSILD 1 Møreforsking MARIN Postboks 5075, NO-6021

Detaljer

Utvidet nyfødtscreening Oppfølgende diagnostikk

Utvidet nyfødtscreening Oppfølgende diagnostikk Utvidet nyfødtscreening Oppfølgende diagnostikk 30. september 2011 Yngve Th. Bliksrud overlege Seksjon for medfødt metabolsk sykdom Avdeling for medisinsk biokjemi OUS, Rikshospitalet Utvidet nyfødtscreening

Detaljer

kammer: 125 ml kammer: 250 ml Glukosemonohydrat = vannfri glukose 158,4 g 144,0 g Natriumdihydrogenfosfatdihydrat

kammer: 125 ml kammer: 250 ml Glukosemonohydrat = vannfri glukose 158,4 g 144,0 g Natriumdihydrogenfosfatdihydrat PREPARATOMTALE 1 1. LEGEMIDLETS NAVN NuTRIflex Lipid special infusjonsvæske, emulsjon. 2. KVALITATIV OG KVANTITATIV SAMMENSETNING Pakningsstørrelse 625 ml: Før blanding Etter blanding Øvre, venstre Øvre,

Detaljer

kammer: 500 ml 250 ml 132,0 g 120,0 g Natriumdihydrogenfosfatdihydrat

kammer: 500 ml 250 ml 132,0 g 120,0 g Natriumdihydrogenfosfatdihydrat PREPARATOMTALE 1 1. LEGEMIDLETS NAVN NuTRIflex Lipid plus infusjonsvæske, emulsjon. 2. KVALITATIV OG KVANTITATIV SAMMENSETNING Pakningsstørrelse 1250 ml: Før blanding Etter blanding I Øvre, II Øvre, III

Detaljer

Tittel: IL-2-MUTEIN FOR BEHANDLING ELLER PROFYLAKSE AV EN AUTOIMMUN SYKDOM

Tittel: IL-2-MUTEIN FOR BEHANDLING ELLER PROFYLAKSE AV EN AUTOIMMUN SYKDOM 1 Tittel: IL-2-MUTEIN FOR BEHANDLING ELLER PROFYLAKSE AV EN AUTOIMMUN SYKDOM Den foreliggende oppfinnelsen vedrører et middel for behandling og/eller profylakse av en autoimmun sykdom. Autoimmune sykdommer

Detaljer

Sammendrag. Sammendrag

Sammendrag. Sammendrag Forord Forord Denne masteroppgaven ble utført høsten 213, samt deler av våren 214, ved Institutt for kjemi, bioteknologi og matvitenskap, Norges miljø og biovitenskapelige universitet. Først og fremst

Detaljer

PAKNINGSVEDLEGG: INFORMASJON TIL BRUKEREN. SmofKabiven Perifer infusjonsvæske, emulsjon

PAKNINGSVEDLEGG: INFORMASJON TIL BRUKEREN. SmofKabiven Perifer infusjonsvæske, emulsjon PAKNINGSVEDLEGG: INFORMASJON TIL BRUKEREN SmofKabiven Perifer infusjonsvæske, emulsjon Les nøye gjennom dette pakningsvedlegget før du begynner å bruke legemidlet. Ta vare på dette pakningsvedlegget. Du

Detaljer

1. LEGEMIDLETS NAVN. Nutrineal PD4 med aminosyrer 1,1%, peritonealdialysevæske 2. KVALITATIV OG KVANTITATIV SAMMENSETNING

1. LEGEMIDLETS NAVN. Nutrineal PD4 med aminosyrer 1,1%, peritonealdialysevæske 2. KVALITATIV OG KVANTITATIV SAMMENSETNING 1. LEGEMIDLETS NAVN Nutrineal PD4 med aminosyrer 1,1%, peritonealdialysevæske 2. KVALITATIV OG KVANTITATIV SAMMENSETNING 1 liter oppløsning inneholder: Alanin Arginin Glysin Histidin Isoleucin Leucin Lysin,

Detaljer

Proteiner i fisk; nye resultater og pågående forskning. Oddrun Anita Gudbrandsen Institutt for indremedisin, UiB nkjgu@med.uib.no

Proteiner i fisk; nye resultater og pågående forskning. Oddrun Anita Gudbrandsen Institutt for indremedisin, UiB nkjgu@med.uib.no Proteiner i fisk; nye resultater og pågående forskning. Oddrun Anita Gudbrandsen Institutt for indremedisin, UiB nkjgu@med.uib.no 1 Poenget med aminosyrer byggesteiner energikilder enzymer gir smak (frie

Detaljer

Tabell. Innvilgede søknader om tillatelse til å tilsette aminosyrer til næringsmidler

Tabell. Innvilgede søknader om tillatelse til å tilsette aminosyrer til næringsmidler Liste Innvilgede søknader om tillatelse til å tilsette aminosyrer til næringsmidler. Sist oppdatert 01.07.2015 Nedenfor vil du finne oversikt over innvilgede søknader om tillatelse til å tilsette aminosyrer

Detaljer

kammer: 500 ml 250 ml 70,4 g 64,0 g Natriumdihydrogenfosfatdihydrat

kammer: 500 ml 250 ml 70,4 g 64,0 g Natriumdihydrogenfosfatdihydrat PREPARATOMTALE 1 1. LEGEMIDLETS NAVN NuTRIflex Lipid peri infusjonsvæske, emulsjon. 2. KVALITATIV OG KVANTITATIV SAMMENSETNING Pakningsstørrelse 1250 ml: Før blanding Etter blanding I Øvre, II Øvre, III

Detaljer

PAKNINGSVEDLEGG: INFORMASJON TIL BRUKEREN. Kabiven infusjonsvæske, emulsjon

PAKNINGSVEDLEGG: INFORMASJON TIL BRUKEREN. Kabiven infusjonsvæske, emulsjon PAKNINGSVEDLEGG: INFORMASJON TIL BRUKEREN infusjonsvæske, emulsjon Les nøye gjennom dette pakningsvedlegget før du begynner å bruke legemidlet. Ta vare på dette pakningsvedlegget. Du kan få behov for å

Detaljer

Robineti termostatici. Jürgen Schlösser Armaturen. Perfection in heating

Robineti termostatici. Jürgen Schlösser Armaturen.  Perfection in heating ARMATUREN Robineti termostatici Jürgen Schlösser Armaturen www.juergen-schloesser-armaturen.de Perfection in heating Descriere tehnică: Robineții termostatici produși de Jürgen Schlösser Armaturen România

Detaljer

HØGSKOLEN I SØR-TRØNDELAG Fakultet for lærer- og tolkeutdanning

HØGSKOLEN I SØR-TRØNDELAG Fakultet for lærer- og tolkeutdanning HØGSKOLEN I SØR-TRØNDELAG Fakultet for lærer- og tolkeutdanning Emnekode(r): Emnenavn: Studiepoeng: LGU53004 Naturfag 2 5-10, emne 1 - Biologi 40 % av 15 studiepoeng Eksamensdato: 8. desember 2015 Varighet/Timer:

Detaljer

PAKNINGSVEDLEGG: INFORMASJON TIL BRUKEREN. Olimel Perifer N4E, infusjonsvæske, emulsjon

PAKNINGSVEDLEGG: INFORMASJON TIL BRUKEREN. Olimel Perifer N4E, infusjonsvæske, emulsjon Legen din må gjøres oppmerksom på: et alvorlig nyreproblem. Du må også informere legen din hvis du får dialyse (benytter kunstig nyre) eller en annen form for blodrensingsbehandling et alvorlig leverproblem

Detaljer

«Spor endringer», utkast til forskrift om endring i forskrift om tilsetning av vitaminer, mineraler og visse andre stoffer til næringsmidler

«Spor endringer», utkast til forskrift om endring i forskrift om tilsetning av vitaminer, mineraler og visse andre stoffer til næringsmidler «Spor endringer», utkast til forskrift om endring i forskrift om tilsetning av vitaminer, mineraler og visse andre stoffer til næringsmidler Hjemmel: Fastsatt av Helse- og omsorgsdepartementet XX. XXXX

Detaljer

Korrektur MOVITRAC LTE-B * _1114*

Korrektur MOVITRAC LTE-B * _1114* Drivteknikk \ Automatisering \ Systemintegrering \ Service *1353107_1114* Korrektur SEW-EURODRIVE GmbH & Co KG P.O. Box 303 7664 Bruchsal/Germany Phone +49 751 75-0 Fax +49 751-1970 sew@sew-eurodrive.com

Detaljer

PREPARATOMTALE. Kabiven er tilgjengelig som en trekammerpose Hver pose inneholder følgende ulike volum avhengig av de fire pakningsstørrelsene.

PREPARATOMTALE. Kabiven er tilgjengelig som en trekammerpose Hver pose inneholder følgende ulike volum avhengig av de fire pakningsstørrelsene. PREPARATOMTALE 1. LEGEMIDLETS NAVN Kabiven infusjonsvæske, emulsjon 2. KVALITATIV OG KVANTITATIV SAMMENSETNING Kabiven er tilgjengelig som en trekammerpose Hver pose inneholder følgende ulike volum avhengig

Detaljer

Sammensetning av fett og protein i oljevekster dyrket i Norge

Sammensetning av fett og protein i oljevekster dyrket i Norge A. K. Uhlen et al. / Grønn kunnskap 8 (2) 117 Sammensetning av fett og protein i oljevekster dyrket i Norge Anne Kjersti Uhlen 1) /anne.kjersti.uhlen@ipm.nlh.no Ellen Kristine Olberg 2) / ellen.kristine.olberg@planteforsk.no

Detaljer

Nr. 25/170 EØS-tillegget til Den europeiske unions tidende. KOMMISJONSFORORDNING (EF) nr. 953/2009. av 13. oktober 2009

Nr. 25/170 EØS-tillegget til Den europeiske unions tidende. KOMMISJONSFORORDNING (EF) nr. 953/2009. av 13. oktober 2009 Nr. 25/170 EØS-tillegget til Den europeiske unions tidende KOMMISJONSFORORDNING (EF) nr. 953/2009 2015/EØS/25/20 av 13. oktober 2009 om stoffer som for særlige ernæringsformål kan tilsettes næringsmidler

Detaljer

Introduksjon til Biokjemi. Ingar Leiros, Institutt for Kjemi, UiT

Introduksjon til Biokjemi. Ingar Leiros, Institutt for Kjemi, UiT Introduksjon til Biokjemi Ingar Leiros, Institutt for Kjemi, UiT Biokjemi Biokjemi (Wikipedia): -Studien av de kjemiske prosesser i levende organismer, eller sagt på en annen måte; det molekylære grunnlaget

Detaljer

OFFICES & ADDRESSES FEBRUARY 2019 BILFINGER TEBODIN

OFFICES & ADDRESSES FEBRUARY 2019 BILFINGER TEBODIN OFFICES & ADDRESSES FEBRUARY 2019 BILFINGER TEBODIN NORTH WEST EUROPE Belgium Bilfinger Tebodin Belgium NV Boereveldseweg 4,Harbor 1062 2070 Zwijndrecht, Antwerp Phone +32 3 250 28 01 info.belgium.tebodin.be@bilfinger.com

Detaljer

METODA REDUCERII LA UNITATE

METODA REDUCERII LA UNITATE METODA REDUCERII LA UNITATE Metoda reducerii la unitate constă în compararea mărimilor date în problemă, cu aceeaşi mărime, luată ca unitate. Această metodă prezintă avantajul că este foarte accesibilă

Detaljer

Proteiner og aminosyrer

Proteiner og aminosyrer Proteiner og aminosyrer Presentasjonsplan 1/2 Introduksjon DNA mrna pep=d Den gene=ske koden: Hva er et codon? Aminosyrer del 1 Hvilke molekyler er dece? (Klassifisering) Kilder og syntese Presentasjonsplan

Detaljer

KOMMISJONSDIREKTIV 96/8/EF. av 26. februar 1996. om næringsmiddel til bruk i kalorifattige diettar med sikte på vekttap(*)

KOMMISJONSDIREKTIV 96/8/EF. av 26. februar 1996. om næringsmiddel til bruk i kalorifattige diettar med sikte på vekttap(*) 13.11.1997 EØS-tillegget til De Europeiske Fellesskaps Tidende Nr.48/57 KOMMISJONSDIREKTIV 96/8/EF av 26. februar 1996 om næringsmiddel til bruk i kalorifattige diettar med sikte på vekttap(*) (Tekst som

Detaljer

Korrektur MOVITRAC LTP-B * _1114*

Korrektur MOVITRAC LTP-B * _1114* Drivteknikk \ Automatisering \ Systemintegrering \ Service *21353506_1114* Korrektur SEW-EURODRIVE GmbH & Co KG P.O. Box 3023 76642 Bruchsal/Germany Phone +49 7251 75-0 Fax +49 7251-1970 sew@sew-eurodrive.com

Detaljer

Råstoffkilder for anvendelse som attraktanter i fabrikkert agn

Råstoffkilder for anvendelse som attraktanter i fabrikkert agn Nr. 18 2016 R A P P O R T F R A H A V F O R S K N I N G E N ISSN 1893-4536 (online) Råstoffkilder for anvendelse som attraktanter i fabrikkert agn Svein Løkkeborg1, André Sture Bogevik2, Odd-Børre Humborstad1,

Detaljer

OFFICES & ADDRESSES FEBRUARY 2019 BILFINGER TEBODIN

OFFICES & ADDRESSES FEBRUARY 2019 BILFINGER TEBODIN OFFICES & ADDRESSES FEBRUARY 2019 BILFINGER TEBODIN NORTH WEST EUROPE Belgium Bilfinger Tebodin Belgium NV Boereveldseweg 4,Harbor 1062 2070 Zwijndrecht, Antwerp Phone +32 3 250 28 01 info.belgium.tebodin.be@bilfinger.com

Detaljer

TBT4170 Bioteknologi Eksamensnotater. Ove Øyås oyas@stud.ntnu.no Sist endret: 5. juni 2011

TBT4170 Bioteknologi Eksamensnotater. Ove Øyås oyas@stud.ntnu.no Sist endret: 5. juni 2011 TBT4170 Bioteknologi Eksamensnotater Ove Øyås oyas@stud.ntnu.no Sist endret: 5. juni 2011 1 Innhold 1 Hva er bioteknologi? 7 2 Livets tre: Hva kom først? 7 3 Prokaryoter, eukaryoter og virus 8 3.1 Prokaryoter...............................

Detaljer

1. LEGEMIDLETS NAVN. Nutrineal PD4 med aminosyrer 1,1%, peritonealdialysevæske

1. LEGEMIDLETS NAVN. Nutrineal PD4 med aminosyrer 1,1%, peritonealdialysevæske 1. LEGEMIDLETS NAVN Nutrineal PD4 med aminosyrer 1,1%, peritonealdialysevæske 2. KVALITATIV OG KVANTITATIV SAMMENSETNING 1 liter oppløsning inneholder: Alanin Arginin Glysin Histidin Isoleucin Leucin Lysin,

Detaljer

10-02. Anne-Hill s spalte. Nucleomega. Cranberry tea. Herbal slim tea. Nytt

10-02. Anne-Hill s spalte. Nucleomega. Cranberry tea. Herbal slim tea. Nytt 10-02 2 4 6 7 8 Anne-Hill s spalte Nucleomega Cranberry tea Herbal slim tea Nytt Høstens nyheter Etter en fantastisk sommer over stor deler av Skandinavia, er høsten kommet, og med den, etterlengtede nyheter

Detaljer

47 Hvem er Skretting? 51 Ernæring. 55 Fiskehelse Skretting ARC 59 63 SEA. 69 MicroBalance. 73 Aktiv Kontroll. 79 ColourSim

47 Hvem er Skretting? 51 Ernæring. 55 Fiskehelse Skretting ARC 59 63 SEA. 69 MicroBalance. 73 Aktiv Kontroll. 79 ColourSim hjerneføde Hva er Skretting? 3 Skretting FQ 47 Hvem er Skretting? 7 Kalkulatorer 51 Ernæring 11 Planlegger 55 Fiskehelse Skretting ARC 23 27 Nutrace Fysisk kvalitet 59 63 SEA 31 Fôringsråd 69 MicroBalance

Detaljer

Innhold og tilsetninger. NuTRIflex Omega. Peri Plus Special Special elektrolyttfri

Innhold og tilsetninger. NuTRIflex Omega. Peri Plus Special Special elektrolyttfri Innhold og tilsetninger NuTRIflex Omega Peri Plus Special Special elektrolyttfri NuTRIflex Omega trekammerposer Praktiske opplysninger Solid opphengshull Praktisk informasjon Oversikt over ernæringsstoffer

Detaljer

PREPARATOMTALE. 1. LEGEMIDLETS NAVN Nutrineal PD4 1,1 % Amino Acids Clear-Flex, Peritonealdialysevæske 2. KVALITATIV OG KVANTITATIV SAMMENSETNING

PREPARATOMTALE. 1. LEGEMIDLETS NAVN Nutrineal PD4 1,1 % Amino Acids Clear-Flex, Peritonealdialysevæske 2. KVALITATIV OG KVANTITATIV SAMMENSETNING PREPARATOMTALE 1. LEGEMIDLETS NAVN Nutrineal PD4 1,1 % Amino Acids ClearFlex, Peritonealdialysevæske 2. KVALITATIV OG KVANTITATIV SAMMENSETNING Formulering i mg/l Aminosyreblanding: Alanin 951 Arginin

Detaljer

Kartlegging av biokjemisk innhold i copepoder som basis for kvalitetsvurdering av fôr i oppdrett av marin fiskeyngel.

Kartlegging av biokjemisk innhold i copepoder som basis for kvalitetsvurdering av fôr i oppdrett av marin fiskeyngel. Kartlegging av biokjemisk innhold i copepoder som basis for kvalitetsvurdering av fôr i oppdrett av marin fiskeyngel. SLUTTRAPPORT Terje van der Meeren Havforskningsinstituttet, Senter for Havbruk, Austevoll

Detaljer

Rapport nr. 308/65 ANVENDELSE AV FISKEBEINMEL Bein separert ved ensilasjeproduksjon

Rapport nr. 308/65 ANVENDELSE AV FISKEBEINMEL Bein separert ved ensilasjeproduksjon Rapport nr. 308/65 ANVENDELSE AV FISKEBEINMEL Bein separert ved ensilasjeproduksjon RAPPORT-TITTEL ANVENDELSE AV FISKEBEINMEL. Bein separert ved ensilasjeproduksjon. RAPPORTNUMMER 308/65 PROSJEKTNUMMER

Detaljer

Eksamensoppgave i TMA4135 Matematikk 4D

Eksamensoppgave i TMA4135 Matematikk 4D Institutt for matematiske fag Eksamensoppgave i TMA435 Matematikk 4D Faglig kontakt under eksamen: Helge Holden a, Gard Spreemann b Tlf: a 92038625, b 93838503 Eksamensdato: 0. desember 205 Eksamenstid

Detaljer

Innhold og tilsetninger. Lipoflex. Peri Plus Special

Innhold og tilsetninger. Lipoflex. Peri Plus Special Innhold og tilsetninger Peri Plus Special trekammerposer Praktiske opplysninger Solid opphengshull Praktisk informasjon Oversikt over ernæringsstoffer og kaloriinnhold Tydelig merking Volumet i ml God

Detaljer

Strategi for utvikling av LC-MS metode som diagnostisk verktøy for kvantifisering av tumormarkøren NSE i humant plasma

Strategi for utvikling av LC-MS metode som diagnostisk verktøy for kvantifisering av tumormarkøren NSE i humant plasma HOVEDFAGSOPPGAVE I LEGEMIDDELANALYSE FOR GRADEN CAND. PHARM. Hanne Lund Strategi for utvikling av LC-MS metode som diagnostisk verktøy for kvantifisering av tumormarkøren NSE i humant plasma Avdeling for

Detaljer

NYHET. NuTRIflex 3-kammerpose til parenteral ernæring. Nyutviklet 3-kammerpose og utvidet produktsortimentet

NYHET. NuTRIflex 3-kammerpose til parenteral ernæring. Nyutviklet 3-kammerpose og utvidet produktsortimentet NYHET NuTRIflex 3-kammerpose til parenteral ernæring Nyutviklet 3-kammerpose og utvidet produktsorntet Posens design Klar Praktisk Brukervennlig Tydelig merking Volumet i ml God oversikt over vesentlig

Detaljer

PRODUKTARK. Appetitt Cat Kitten. Fullfôr til kattunger fram til 1 års alder. Næringsinnhold Energi, omsettelig pr. (NRC, 2006)

PRODUKTARK. Appetitt Cat Kitten. Fullfôr til kattunger fram til 1 års alder. Næringsinnhold Energi, omsettelig pr. (NRC, 2006) PRODUKTARK Appetitt Cat Kitten Fullfôr til kattunger fram til 1 års alder Næringsinnhold Energi, omsettelig pr. (NRC, 2006) 4487 kcal Hovednæringstoffer Protein 37,00 % Fett 20,00 % Fiber 1,50 % Kostfiber

Detaljer

Bioaktive stoffer i torskemuskel - som kan forebygge diabetes II. Revidert sluttrapport mai 2009

Bioaktive stoffer i torskemuskel - som kan forebygge diabetes II. Revidert sluttrapport mai 2009 Rapport 30/2008 Utgitt desember 2008 Bioaktive stoffer i torskemuskel - som kan forebygge diabetes II. Revidert sluttrapport mai 2009 Asbjørn Gildberg, Britt Nanny Fuglesteg og Even Stenberg Nofima er

Detaljer

PRODUKTARK. Appetitt Kitten. Fullfôr til kattunger fram til 1 års alder. Næringsinnhold Energi, omsettelig pr. kg (NRC 2006)

PRODUKTARK. Appetitt Kitten. Fullfôr til kattunger fram til 1 års alder. Næringsinnhold Energi, omsettelig pr. kg (NRC 2006) PRODUKTARK Appetitt Kitten Fullfôr til kattunger fram til 1 års alder Næringsinnhold Energi, omsettelig pr. kg (NRC 2006) 4445 kcal Hovednæringstoffer Protein 37,00 % Fett 20,00 % Fiber 1,50 % Kostfiber

Detaljer

HØGSKOLEN I SØR-TRØNDELAG

HØGSKOLEN I SØR-TRØNDELAG ØGSKLEN I SØR-TRØNDELAG INSTITUTT FR NÆRINGSMIDDELFAG Kand.nr. Fagnavn: rganisk- og næringsmiddelkjemi Fagnummer: F130N Eksamensdato: 14.05.2002 Kl. 09.00-14.00 Klasse(r): 1N. Vekttall: 3 Faglærer(e):

Detaljer

Eksamen i TMA4123/TMA4125 Matematikk 4M/N

Eksamen i TMA4123/TMA4125 Matematikk 4M/N Norges teknisk naturvitenskapelige universitet Institutt for matematiske fag Side av 7 Faglig kontakt under eksamen: Anne Kværnø: mobil 92663824 Eksamen i TMA423/TMA425 Matematikk 4M/N Bokmål Mandag 2.

Detaljer

HØGSKOLEN I SØR-TRØNDELAG Avdeling for teknologi

HØGSKOLEN I SØR-TRØNDELAG Avdeling for teknologi HØGSKOLEN I SØR-TRØNDELAG Avdeling for teknologi Eksamensdato: 19.5.211 Varighet/eksamenstid: Emnekode: 5 timer EDT24T Emnenavn: Signalbehandling 1 Klasse(r): 2EE Studiepoeng: 1 Faglærer(e): Håkon Grønning

Detaljer

Dagens temaer. Endelig lengde data. Tema. Time 11: Diskret Fourier Transform, del 2. Spektral glatting pga endelig lengde data.

Dagens temaer. Endelig lengde data. Tema. Time 11: Diskret Fourier Transform, del 2. Spektral glatting pga endelig lengde data. Dagens temaer Time : Diskret Fourier Transform, del Andreas Austeng@ifi.uio.no, INF37 Institutt for informatikk, Universitetet i Oslo Spektral glatting pga endelig lengde data Bruk av en Frekvensestimering

Detaljer

XRR. Rundt rør / Round tubes. Rundt rør / Round tubes. www.hap.hydal.com. I W icm 5130 14 1,5 0,159 0,12 0,17 0,45 1 0,110 0,09 0,12 0,46

XRR. Rundt rør / Round tubes. Rundt rør / Round tubes. www.hap.hydal.com. I W icm 5130 14 1,5 0,159 0,12 0,17 0,45 1 0,110 0,09 0,12 0,46 i D i 5 0,0 0,0 0,5 000 5,5 0,0 0,0 0,0 0,0 0, 0,5 000 000 9,5,5,5 0,0 0,0 0,0 0,0 0,9 0, 000 000 9,5 0,5 0,0 6 0,0 0,0 0,06 0, 0,9 000 000 0 0 0,5 6 0,0 0,0 0,0 0,06 0, 0, 0005 000 0 0,5 0,0 0,6 0,0 0,0

Detaljer